Identifiers and Description

Gene Model Identifier

TTHERM_00378790

Standard Name

None

Aliases

PreTt10333 | 40.m00218

Description

scavenger mRNA decapping enzyme carboxy-term-binding protein; HIT domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01230 ) histidine triad domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00378790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00095.13.0005221502158484e-68HIT domain-containing protein
(151 aa)
DictyBaseDDB_G02742578.000124778438792e-23fhit on chromosome: 2 position
4124527 to 4125207
WormBaseWBGene000035941.9999391735788327e-19locus:nft-1 Nitrilase and fr
agile histidine triad fusion p
rotein NitFhit status:Confir
med UniProt:O76463 protein
_id:CAB60517.1
OxytrichaContig22673.0.g979.995317835403734e-19HIT domain
SGDYDR305C0.0000000000000299873730555305HNT2 Dinucleoside triphosphate
hydrolase; has similarity to
the tumor suppressor FHIT and
belongs to the histidine triad
(HIT) superfamily of nucleoti
de-binding proteins

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00378790(coding)
ATGAGTGCAAGCGTTGTGGCAAATTTAACAGTTTAATTTGGAAAGAGTTAGCTTCCTCTT
TCTTAAATATTCATTCTTAGAAAGAATGTTTTTGCAACAACTAATTTAAAGCCTGCTTGT
CCAGGACATGTTTTAGTGGCTTCAAGAAGACCAGTAAAACGTCTCCATGAATTGACAGAA
GTTGAAACACTTGATCTTTGGACTACGGTACAGTAGGTTTCCAGAGTCATGGAATAAATA
CATAAATTCCCTTGTTAAATCGGGGTTCAAGATGGAACTGATGCAGGTTAAACTATTGAT
CACGTTCATATTCACATTATTCCTTTCCCAAAAGAATATAGCCAAGATGTTATTATGGAT
AGCGAAGGTAGAATAAAATGCAATTTAAATGAGGAAAATTAAATTTAAAAATATTATTAA
ATTTAGAAAGACCTCCTAGAACAGCAGATGATATGGCCAAAGAAGCTGACAAATATAGAA
CTTACTTTGAATAAGGGTCAAACTAGTAGTATTGATTAAATATAAATAGATTAAAGCATA
TAATTAAATAGTTTTATTAATGTAAATAATATATTTTTAGATGATATTTGTAGCTATGTA
TTTAGGTAATGTAATTAATTTATTTTAAAATACTATGCTTTACAAAAATATGATTCAGCT
AATCAATACATAGATAAATAGATAGATATTCTTTGTTTAAAATATATGATAAGCAAAATT
AGTATTGTAGATAAACATTTACATATAATTTTTTATATAAAAATATCATTAAAATTATAA
TAGGAAGGATAGCTAAAAGTAGATCGATTGTTTGTTTGTTTGTTTGATTGA


>TTHERM_00378790(protein)
MSASVVANLTVQFGKSQLPLSQIFILRKNVFATTNLKPACPGHVLVASRRPVKRLHELTE
VETLDLWTTVQQVSRVMEQIHKFPCQIGVQDGTDAGQTIDHVHIHIIPFPKEYSQDVIMD
SEGRIKCNLNEENQIQKYYQIQKDLLEQQMIWPKKLTNIELTLNKGQTSSIDQIQIDQSI
QLNSFINVNNIFLDDICSYVFRQCNQFILKYYALQKYDSANQYIDKQIDILCLKYMISKI
SIVDKHLHIIFYIKISLKLQQEGQLKVDRLFVCLFD


>TTHERM_00378790(gene)
ATGAGTGCAAGCGTTGTGGCAAATTTAACAGTTTAATTTGGAAAGAGTTAGCTTCCTCTT
TCTTAAATATTCATTCTTAGAAAGAATGTTTTTGCAACAACTAATTTAAAGCCTGCTTGT
CCAGGACATGTTTTAGTGGCTTCAAGAAGACCAGTAAAACGTCTCCATGAATTGACAGAA
GTTGAAACACTTGATCTTTGGACTACGGTACAGTAGGTTTCCAGAGTCATGGAATAAATA
CATAAATTCCCTTGTTAAATCGGGGTTCAAGATGGAACTGATGCAGGTAAATTTATCAAA
AATATACTTAGTTATATTTTAAATGAGAATAAATGATTGATAATTATGATCATATAAATT
TAAAAAAAGGTTAAACTATTGATCACGTTCATATTCACATTATTCCTTTCCCAAAAGAAT
ATAGCCAAGATGTTATTATGGATAGCGAAGGTAGAATAAAATGCAATTTAAATGAGGAAA
ATTAAATTTAAAAATATTATTAAATTTAGAAAGACCTCCTAGAACAGCAGATGATATGGC
CAAAGAAGCTGACAAATATAGAACTTACTTTGAATAAGGGTCAAACTAGTAGTATTGATT
AAATATAAATAGATTAAAGCATATAATTAAATAGTTTTATTAATGTAAATAATATATTTT
TAGATGATATTTGTAGCTATGTATTTAGGTAATGTAATTAATTTATTTTAAAATACTATG
CTTTACAAAAATATGATTCAGCTAATCAATACATAGATAAATAGATAGATATTCTTTGTT
TAAAATATATGATAAGCAAAATTAGTATTGTAGATAAACATTTACATATAATTTTTTATA
TAAAAATATCATTAAAATTATAATAGGAAGGATAGCTAAAAGTAGATCGATTGTTTGTTT
GTTTGTTTGATTGA