Identifiers and Description

Gene Model Identifier

TTHERM_00375098

Standard Name

None

Aliases

3693.m00902

Description

Protein C14orf120, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04000 ) Sas10/Utp3/C1D family
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF06991 ) Micro-fibrillar-associated protein 1 C-terminus
  • ( PF00594 ) Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00375098

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12356.19.997093137033517e-262protein C14 (552 aa)
DictyBaseDDB_G02699720.000000000000004001928599951003sas10 on chromosome: 1 positio
n 3952196 to 3954580
OxytrichaContig152.1.g190.000000007998594485613997Sas10 C-terminal domain
WormBaseWBGene000030590.00000019998969434520019locus:lpd-2 status:Confirmed
UniProt:Q8IG68 protein_id
:CCD64206.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00375098(protein)
MAGNKQKPIKKVKQPSSEEEEEDEDIELDSDQLAQLEDSDDLVGHVEDSDEDEQDQEELE
GDYDEDESLNSDEIPNLSITEDEDDNKASKKGKLKVNLNEDSNSVLGDLNDDDNDDDEEE
ESGDDSNLQDQDLDNIEAEYSEEDEEDEKDKELFQQNVNSSNYFEKILKISKQNLSQIEN
VELIQDILKKKNISKIDLEKEEIYQNDQGEFKKLIDEMSKNSKDEESKLYPITKLTRSKN
LNLEQGISLLNSKNEIFSNYLICLHFYMLYKLNGISLKDSPVVKKLIYYKTLLSKLKPVE
QKMEYQISKLMKFSLKTSEQGKGTKTSTSISQDPISFKPRPELIDDSQGEEDDQEQEDIS
ENVSNLSDEEETKAKKQVIKKKPVAKYVAPKTMAVQQDKAERRLEVEKKRREAYLMRQLK
ANINADINEIKNDRPVVERFAETDKIAKRESEIQKYELNNFVRLQRSKQDKKRIKEFEKN
KAKLDRIDDMSEQKYIRELLHHQKLAVDPEFEKKEKQNLQQTLQKYNKNKNEKQGGNKFN
NGGNKFNNSGNKFNKGPKPTKKFKKN


>TTHERM_00375098(coding)
ATGGCTGGCAATAAGTAAAAACCAATTAAAAAGGTTAAATAACCTTCATCTGAAGAAGAA
GAGGAAGATGAAGACATAGAATTAGATAGCGATTAGTTAGCATAATTAGAAGATAGTGAT
GATTTAGTTGGTCATGTAGAAGATAGTGATGAAGATGAGCAAGACTAAGAAGAATTAGAA
GGCGATTATGATGAAGATGAAAGCCTCAATTCAGATGAAATTCCTAATCTCAGTATCACA
GAAGATGAAGATGACAATAAAGCATCAAAGAAAGGAAAACTAAAAGTTAATTTAAACGAA
GATTCAAATTCTGTTCTTGGTGATTTGAATGATGATGATAATGATGATGACGAAGAAGAA
GAATCTGGTGATGATAGCAATTTGTAAGATTAGGATTTAGATAATATTGAAGCTGAATAC
TCTGAAGAAGACGAAGAAGATGAAAAGGACAAAGAATTGTTCTAATAAAATGTTAACAGC
TCAAATTACTTTGAAAAAATATTAAAAATTAGCAAACAAAATTTATCTTAAATTGAAAAT
GTCGAATTAATTCAAGATATTTTAAAGAAGAAAAATATTTCTAAAATTGACCTTGAAAAG
GAAGAAATATATCAAAATGATTAAGGGGAATTTAAAAAGCTTATTGATGAGATGAGCAAA
AACTCAAAGGATGAAGAGTCTAAATTATATCCAATAACCAAGTTGACCAGATCTAAAAAT
CTAAATTTAGAATAGGGAATAAGTTTACTTAATTCTAAGAATGAAATATTTTCTAATTAC
CTTATTTGTTTACACTTTTATATGCTCTACAAGTTAAATGGCATTTCTCTTAAAGATTCA
CCTGTAGTCAAAAAACTCATTTATTATAAAACACTCCTTTCTAAACTTAAACCAGTTGAA
TAAAAGATGGAATATCAAATCTCTAAGTTGATGAAATTTTCTCTTAAAACATCTGAATAA
GGAAAAGGAACAAAGACTTCAACTAGTATTTCCCAAGATCCTATTAGTTTTAAGCCTCGC
CCTGAATTGATAGATGATAGTTAAGGAGAAGAAGATGACTAAGAACAAGAAGATATTTCT
GAAAATGTTTCTAATCTTTCTGATGAAGAAGAAACTAAAGCCAAAAAGTAGGTGATAAAG
AAGAAACCAGTAGCAAAGTATGTTGCTCCTAAGACTATGGCTGTTCAGCAAGATAAAGCA
GAAAGAAGATTAGAAGTTGAAAAAAAGAGAAGAGAAGCTTATCTTATGAGATAATTAAAA
GCTAATATTAACGCTGATATCAACGAAATCAAGAATGATAGACCAGTTGTTGAGAGATTT
GCAGAAACAGACAAGATCGCTAAAAGAGAAAGCGAAATATAAAAGTACGAATTAAATAAT
TTTGTAAGATTACAAAGATCTAAGTAAGATAAAAAGAGAATTAAAGAATTTGAAAAAAAT
AAAGCAAAACTTGATAGAATCGATGACATGAGTGAACAAAAATATATTAGAGAACTTTTA
CACCATTAAAAGCTTGCTGTTGATCCTGAATTTGAAAAAAAAGAAAAATAAAACTTGCAA
TAAACATTATAAAAATATAATAAAAATAAAAACGAAAAATAAGGTGGAAATAAATTTAAC
AATGGTGGAAATAAATTTAACAATAGTGGAAATAAATTTAACAAAGGTCCCAAACCTACT
AAAAAATTTAAAAAGAATTGA


>TTHERM_00375098(gene)
ATGGCTGGCAATAAGTAAAAACCAATTAAAAAGGTTAAATAACCTTCATCTGAAGAAGAA
GAGGAAGATGAAGACATAGAATTAGATAGCGATTAGTTAGCATAATTAGAAGATAGTGAT
GATTTAGTTGGTCATGTAGAAGATAGTGATGAAGATGAGCAAGACTAAGAAGAATTAGAA
GGCGATTATGATGAAGATGAAAGCCTCAATTCAGATGAAATTCCTAATCTCAGTATCACA
GAAGATGAAGATGACAATAAAGCATCAAAGAAAGGAAAACTAAAAGTTAATTTAAACGAA
GATTCAAATTCTGTTCTTGGTGATTTGAATGATGATGATAATGATGATGACGAAGAAGAA
GAATCTGGTGATGATAGCAATTTGTAAGATTAGGATTTAGATAATATTGAAGCTGAATAC
TCTGAAGAAGACGAAGAAGATGAAAAGGACAAAGAATTGTTCTAATAAAATGTTAACAGC
TCAAATTACTTTGAAAAAATATTAAAAATTAGCAAACAAAATTTATCTTAAATTGAAAAT
GTCGAATTAATTCAAGATATTTTAAAGAAGAAAAATATTTCTAAAATTGACCTTGAAAAG
GAAGAAATATATCAAAATGATTAAGGGGAATTTAAAAAGCTTATTGATGAGATGAGCAAA
AACTCAAAGGATGAAGAGTCTAAATTATATCCAATAACCAAGTTGACCAGATCTAAAAAT
CTAAATTTAGAATAGGGAATAAGTTTACTTAATTCTAAGAATGAAATATTTTCTAATTAC
CTTATTTGTTTACACTTTTATATGCTCTACAAGTTAAATGGCATTTCTCTTAAAGATTCA
CCTGTAGTCAAAAAACTCATTTATTATAAAACACTCCTTTCTAAACTTAAACCAGTTGAA
TAAAAGATGGAATATCAAATCTCTAAGTTGATGAAATTTTCTCTTAAAACATCTGAATAA
GGAAAAGGAACAAAGACTTCAACTAGTATTTCCCAAGATCCTATTAGTTTTAAGCCTCGC
CCTGAATTGATAGATGATAGTTAAGGAGAAGAAGATGACTAAGAACAAGAAGATATTTCT
GAAAATGTTTCTAATCTTTCTGATGAAGAAGAAACTAAAGCCAAAAAGTAGGTGATAAAG
AAGAAACCAGTAGCAAAGGTAGATTTAATAAAATGAGTGATTTTATTTATTTATTTATAT
ATTATTTAATGAATGATATTATAGTATGTTGCTCCTAAGACTATGGCTGTTCAGCAAGAT
AAAGCAGAAAGAAGATTAGAAGTTGAAAAAAAGAGAAGAGAAGCTTATCTTATGAGATAA
TTAAAAGCTAATATTAACGCTGATATCAACGAAATCAAGAATGATAGACCAGTTGTTGAG
AGATTTGCAGAAACAGACAAGATCGCTAAAAGAGAAAGCGTATTTATTTTTTTATTTTAT
TATAAAATTTTAACTAACAAATTTGTTTTTTTTAGGAAATATAAAAGTACGAATTAAATA
ATTTTGTAAGATTACAAAGATCTAAGTAAGATAAAAAGAGAATTAAAGAATTTGAAAAAA
ATAAAGCAAAACTTGATAGAATCGATGACATGAGTGAACAAAAATATATTAGAGAACTTT
TACACCATTAAAAGCTTGCTGTTGATCCTGAATTTGAAAAAAAAGAAAAATAAAACTTGC
AATAAACATTATAAAAATATAATAAAAATAAAAACGAAAAATAAGGTGGAAATAAATTTA
ACAATGGTGGAAATAAATTTAACAATAGTGGAAATAAATTTAACAAAGGTCCCAAACCTA
CTAAAAAATTTAAAAAGAATTGA