Identifiers and Description

Gene Model Identifier

TTHERM_00372480

Standard Name

ACT2

Aliases

PreTt28662 | 39.m00235 | 3693.m00081

Description

actin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00372480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000000649.997093137033517e-262locus:act-2 Actin-2 status
:Confirmed UniProt:P10984
protein_id:CAB04675.1
Tetrahymena borealisEI9_05617.19.997093137033517e-262actin family protein (375 aa)
DictyBaseDDB_G02750239.997093137033517e-262act22 on chromosome: 2 positio
n 5343575 to 5344705
SGDYFL039C9.997093137033517e-262ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions
OxytrichaContig4562.0.g742.0009778678102968e-172Actin
Stentor CoeruleusSteCoe_322514.961148436415422e-78

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00372480(coding)
ATGTCTGAAACTTCTCCTGCTGTAGTTATTGATAATGGATCTGGAAGATGCAAAGCTGGT
ATAGCTGGCGATGATGCTCCTAGAACTGATTTTCCTTCAATAGTTGGTAGACCAAAATAT
TTAAATACAACTTTTGAATAAAAGGAAATCTACATTGGAGATGAAGCTTTAGCTAAAAAA
GGTGTATTGAATTTATAATATCCTATTGAGCATGGTGTAGTTACTAACTACGATGATATG
GAATAAATATGGCAACATTGTTTCTATAATGAACTAAGAATTGATCCATCCGAACATCCA
TGCATGTTGACTGAAGCTCCCATGAATCCTAAGTAAAACAGAGAAAAAATGGCAAGGACT
ATGTTTGAAACATTCAATGTCCCTTCATTTTATGTATAAATTTAAGCTGTCTTATCTTTG
TATTCTGCTGGTAGAGTTACAGGTATTGTTGTAGATTCTGGTGACGGTGTTACCCATACA
GTTCCTATATTTGAAGGATTTGCATTACCTCATGCTATAAAAAAAAATGAGTTAGCTGGT
AGAGATCTTACTGAATACTTAATGAAACTGATGTATGAAGTTGGTTTGAATTTTTATTCT
TCAGCTGAGAGGGAAATAATAAGAGACATTAAAGAAAAATGTTGTTATGTAGCACTCGAT
TATGAAGCAGAATTAAAGGCTTACTAAAATAATTCTTCTAAACATAAATAATATGAATTA
CCTGATGGAAATATGGTCACAGTTTAGGATTAAAGATTTAGAGTCCCTGAGTTACTTTTC
AAACCTCACTTTATTGGTAAAGAATATAAAGGAATAAGTGAACTAGCATTTGACTCCATT
ATGAGCTGTGATATCGATGTTAGAAGAGATCTTTATGAAAATATTGTTTTATCTGGAGGT
ACAACTATGTTTGATGGTATAGCAGAAAGAATATCCAAGGATATTAGTGCTCTTGCTCCA
CCTGGTATTAAAGTTAGAGTAGTAGCTCCACCAGAAAGAAAATACTCAGTTTTTATTGGT
GGATCAATCTTATCATCCCTTTCATCTTTCTAATCTTCTTGGGTTACTAGGGCTGAATAT
GATGAAGTAGGTCCAACAATTGTTCACAGAAAATGTTTTTGA


>TTHERM_00372480(protein)
MSETSPAVVIDNGSGRCKAGIAGDDAPRTDFPSIVGRPKYLNTTFEQKEIYIGDEALAKK
GVLNLQYPIEHGVVTNYDDMEQIWQHCFYNELRIDPSEHPCMLTEAPMNPKQNREKMART
MFETFNVPSFYVQIQAVLSLYSAGRVTGIVVDSGDGVTHTVPIFEGFALPHAIKKNELAG
RDLTEYLMKLMYEVGLNFYSSAEREIIRDIKEKCCYVALDYEAELKAYQNNSSKHKQYEL
PDGNMVTVQDQRFRVPELLFKPHFIGKEYKGISELAFDSIMSCDIDVRRDLYENIVLSGG
TTMFDGIAERISKDISALAPPGIKVRVVAPPERKYSVFIGGSILSSLSSFQSSWVTRAEY
DEVGPTIVHRKCF


>TTHERM_00372480(gene)
ATGTCTGAAACTTCTCCTGCTGTAGTTATTGATAATGGATCTGGAAGATGCAAAGCTGGT
ATAGCTGGCGATGATGCTCCTAGAACTGATTTTCCTTCAATAGTTGGTAGACCAAAATAT
TTAAATACAACTTTTGAATAAAAGGAAATCTACATTGGAGATGAAGCTTTAGCTAAAAAA
GGTGTATTGAATTTATAATATCCTATTGAGCATGGTGTAGTTACTAACTACGATGATATG
GAATAAATATGGCAACATTGTTTCTATAATGAACTAAGAATTGATCCATCCGAACATCCA
TGCATGTTGACTGAAGCTCCCATGAATCCTAAGTAAAACAGAGAAAAAATGGCAAGGACT
ATGTTTGAAACATTCAATGTCCCTTCATTTTATGTATAAATTTAAGCTGTCTTATCTTTG
TATTCTGCTGGTAGAGTTACAGGTAATTTTTTTACATATAAAAGTTTAACAAATTATAAA
TAATTATTAATTTAAAAATATAAATTTATTTAAAAATTTTAAAATATTTTTTAGGTATTG
TTGTAGATTCTGGTGACGGTGTTACCCATACAGTTCCTATATTTGAAGGATTTGCATTAC
CTCATGCTATAAAAAAAAATGAGTTAGCTGGTAGAGATCTTACTGAATACTTAATGAAAC
TGATGTATGAAGTTGGTTTGAATTTTTATTCTTCAGCTGAGAGGGAAATAATAAGAGACA
TTAAAGAAAAATGTTGTTATGTAGCACTCGATTATGAAGCAGAATTAAAGGCTTACTAAA
ATAATTCTTCTAAACATAAATAATATGAATTACCTGATGGAAATATGGTCACAGTTTAGG
ATTAAAGATTTAGAGTCCCTGAGTTACTTTTCAAACCTCACTTTATTGGTAAAGAATATA
AAGGAATAAGTGAACTAGCATTTGACTCCATTATGAGCTGTGATATCGATGTTAGAAGAG
ATCTTTATGAAAATATTGTTTTATCTGGAGGTACAACTATGTTTGATGGTATAGCAGAAA
GAATATCCAAGGATATTAGTGCTCTTGCTCCACCTGGTATTAAAGTTAGAGTAGTAGCTC
CACCAGAAAGAAAATACTCAGTTTTTATTGGTGGATCAATCTTATCATCCCTTTCATCTT
TCTAATCTTCTTGGGTTACTAGGGCTGAATATGATGAAGTAGGTCCAACAATTGTTCACA
GAAAATGTTTTTGA