Identifiers and Description

Gene Model Identifier

TTHERM_00355740

Standard Name

None

Aliases

PreTt27560 | 37.m00277 | 3836.m02366

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF07381 ) Protein of unknown function (DUF1495)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00355740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02258.19.997093137033517e-262protein kinase domain-containi
ng protein (705 aa)
OxytrichaContig11760.0.0.g742.000065869309806e-55Protein kinase domain
DictyBaseDDB_G02750573.999458587140588e-43DDB_G0275057 on chromosome: 2
position 5089988 to 5091525
WormBaseWBGene000005532.999884853455273e-42locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
SGDYPL153C1.9998323414791308e-36RAD53 Protein kinase, required
for cell-cycle arrest in resp
onse to DNA damage; activated
by trans autophosphorylation w
hen interacting with hyperphos
phorylated Rad9p; also interac
ts with ARS1 and plays a role
in initiation of DNA replicati
on
Stentor CoeruleusSteCoe_199008.75651076269652e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355740(coding)
ATGAAAATTAAAACTAATGGTTGGCTATTCGCCTCACAAAAATCTTCAAATTAATAGTCA
ATATGGTTGAAAGAAAAAAAACCTCTCAAATAATCAGATTTAATGAATTTATAAGTTACA
CCTAGCTATTTTTAAAAGCGCACTAAAACATTCAAGAGACTCGTAAAGCGATACTACTAT
ATTGCTAATAATACTCTATATTATTGCGAGAAATAAAAAAGCACATCGATAAAAGGAATG
TTAGATCTCAGCTTAGTTTATGCAGAATTTTATGAATCCAAAGTGAAAATCTTAAAAAAT
AACACGTATATTATTTGTTTGCGATAAGATTCCTCCTTTGTAGAACTATTAACAGAAAAT
AAACAAATATTTAATGAATGGTGTGTTGTTCTAAGAAGATGCTGTATTATGCTTGACTTT
CATAACTAGTTTAATATACTTAAAATGATTGGTAAAGGTGGATTTTCAAGAGTATTTCTT
GCTTAGGATAAGTTTTCACGTGAAAATTATGCAATAAAAGTTATAACTAAAGACAAGTTA
TTATAGTAAACAAAGGGAATTAAATCTCTGCTTAACGAAATATAGATAATGAAAGAACTT
GATAATGTAAATGGATGTCTTAAATTAATTGGTGTTTACGAAACAGACAGCTCTGTAAAT
CTGATCTTAGAATATATCAAAGGTGGTGAGCTAGTAAAAAAAATAAAATTAAAAGACAAA
TAAAACTTTACTATAGAAAATATGAGATAACTTATGTAAAATATACTGATTGCCCTTGCA
CATATACATCAAAGAAAGATTATCCACAGAGATTTAAAACCAGATAATATCCTAATTGAA
GATGATATTAATTCTACTAAAATAAAAATAGCTGATTTTGGCCTAGCTACTTATGATAGT
ACTGTATTAAATGATTTTTTATTTAAAAAATGTGGTACTCCTGGTTTCTTAGCTCCAGAA
GTTCTTTCAAACAAAGATACACATAAACTATATGACCATAAAGTGGATGTCTTTAGTGCT
GGCGTTATTTTTTACATACTATTATGTGGTCAATAACCTTTCAAAGGAAGCAATCACAGA
TAAGTAGTTGAGTAAAATAAAAAATGTGAAATTGATTTTTAAATACTGGATTCAAATTAA
AAAATCCCTTAAGCAGCTAAAATTTTGGTAAAGTAAATGTTAGCTAAAGACCCTATCAAT
AGACCTACATCGCAAGAGTGTCTTAACAGCCCATTCTTTAAAGAAAATATCATCAATAAC
TCTCTTCACTTCGATTTACATAACTACGAAAATTAAAAATTATAATCATTAGATGGACTT
AATAGACTTAAAATAGATTCTTTAGATAAGAATTCTTAAAATGATTTGTATTGGGTTAAT
CCTGTGTGGAAAGGCTAGACAAATACTGTTTAAACAGTGACAAAGCTATCTTCAATATAC
TTGTAAATAAATGATGTTAGAAAAAGAAATAAAAGCAACTTTGCTCCTATAAATGTTCAT
GCTGAGGAAAGTAAAGATGATGATAGTGGAATAGCTAGCTCTGTTAGAGAAAAAAGAAGT
GCCAGTGCTGATTGCGATTTCAGAAATAAATATTTGCAAAATCAGAGTCTTCATATAACA
GTGTTAAAGAAGTAAAAATAAGGAGATGAATAAACAAACAATGATAACCCAGAAGCGTCT
ATTGATAATAATATTGATTGTATAGAAGAAAATTTTGATGTAAGCGGATATGACTTAAAA
AATAGTTTGGACTAATAAGAATAAAATAAAAATGAAGACTAATTTAAATAATAAAATAGT
GATTATAATAATAACTAATTAAATCTGAAGGCTTCATAATTTAAAAAGAGTCAATTTTTA
GATTCAAACAGGGACGAATACAAACCTAGCATGAAATCTAGTGGATGGGAAAGCATCGAA
AATGAACCATAAATTAACAAGCAAGGTTTAAATTAAAATAGATTAGAAAACAAATACTCT
TTAAAGCCTTTCCAAAATATGGAGGCGATAAATGTTTAATACCCAACTTTTATGAGCTAA
ATTTCTTAAAAGGAGCGTTAAGATGTGAGGCTCAGCAATATCATTTCAGATGAAAAAGTG
AATATGGATGAAGATTTCTATAATAAGCAATACTCTTCAAATAGAAGCATAGAGTATAAT
CTAAAAAAAAATGAAGCACTTGAAAATCATTGCTAAAAAGTAAACCACATCAAAATAAAA
CTTAGAGATTTTAATAGCTCAAGTATGTGGTACAACCCAATATAATAAATAGTTGCTGCT
CCAAGTATTCTAAGCAAGGAAAATTAGAATTATAATTCAGAAGCTTTTGAAGACGAACAG
CATCAATACTACTCAAGGCAAGGGATTAGAAACAGTACATACAATTAGAATAGTTGCCAA
GAAGCCGATTTTAGAGTGAGCGAAGTAGAAGAAAATATAAGTTCAAGGCATTTTACTACA
ATAAATCGTAATCTCATTTTTAGATACAATCCCTTCGACTGCAATGTGTGTTTATGA


>TTHERM_00355740(protein)
MKIKTNGWLFASQKSSNQQSIWLKEKKPLKQSDLMNLQVTPSYFQKRTKTFKRLVKRYYY
IANNTLYYCEKQKSTSIKGMLDLSLVYAEFYESKVKILKNNTYIICLRQDSSFVELLTEN
KQIFNEWCVVLRRCCIMLDFHNQFNILKMIGKGGFSRVFLAQDKFSRENYAIKVITKDKL
LQQTKGIKSLLNEIQIMKELDNVNGCLKLIGVYETDSSVNLILEYIKGGELVKKIKLKDK
QNFTIENMRQLMQNILIALAHIHQRKIIHRDLKPDNILIEDDINSTKIKIADFGLATYDS
TVLNDFLFKKCGTPGFLAPEVLSNKDTHKLYDHKVDVFSAGVIFYILLCGQQPFKGSNHR
QVVEQNKKCEIDFQILDSNQKIPQAAKILVKQMLAKDPINRPTSQECLNSPFFKENIINN
SLHFDLHNYENQKLQSLDGLNRLKIDSLDKNSQNDLYWVNPVWKGQTNTVQTVTKLSSIY
LQINDVRKRNKSNFAPINVHAEESKDDDSGIASSVREKRSASADCDFRNKYLQNQSLHIT
VLKKQKQGDEQTNNDNPEASIDNNIDCIEENFDVSGYDLKNSLDQQEQNKNEDQFKQQNS
DYNNNQLNLKASQFKKSQFLDSNRDEYKPSMKSSGWESIENEPQINKQGLNQNRLENKYS
LKPFQNMEAINVQYPTFMSQISQKERQDVRLSNIISDEKVNMDEDFYNKQYSSNRSIEYN
LKKNEALENHCQKVNHIKIKLRDFNSSSMWYNPIQQIVAAPSILSKENQNYNSEAFEDEQ
HQYYSRQGIRNSTYNQNSCQEADFRVSEVEENISSRHFTTINRNLIFRYNPFDCNVCL


>TTHERM_00355740(gene)
ATGAAAATTAAAACTAATGGTTGGCTATTCGCCTCACAAAAATCTTCAAATTAATAGTCA
ATATGGTTGAAAGAAAAAAAACCTCTCAAATAATCAGATTTAATGAATTTATAAGTTACA
CCTAGCTATTTTTAAAAGCGCACTAAAACATTCAAGAGACTCGTAAAGCGATACTACTAT
ATTGCTAATAATACTCTATATTATTGCGAGGTAGAAATATATTTTACTATCATATTCAAA
AAAAAATAATTTATACCTTTAAAAGAAAATGAATAAATCGACATATTATAATTCATTTTT
AGTCACTAATAAAATTACGAAAATTGATTTATGACTACATTTTTAACTAATTCATTTTTA
AAGATCTATTAAATCTTATAAGTATAAAAATAAAATCATATTTGGTTTCTAAATTATAAT
AAATATTGATATAGAAATAAAAAAGCACATCGATAAAAGGAATGTTAGATCTCAGCTTAG
TTTATGCAGAATTTTATGAATCCAAAGTGAAAATCTTAAAAAATAACACGTATATTATTT
GTTTGCGATAAGATTCCTCCTTTGTAGAACTATTAACAGAAAATAAACAAATATTTAATG
AATGGTGTGTTGTTCTAAGAAGATGCTGTATTATGCTTGACTTTCATAACTAGTTTAATA
TACTTAAAATGATTGGTAAAGGTGGATTTTCAAGAGTAAAATATTATGTTTTATACAATT
TTATTGTTCTATTATTTATAACACAAGATAATTCTAAAGCATTTAGTTGACTTTCTTTTA
ATCAATTAATTTTTAGTGATATTCAAAGAAAACTCTAATCATTAAATAAATCAATCAAAG
GTGTTTAAAAAATCTAATACCAGATTTTATAAATATTAATTTATTGAGATAATTAAAAAT
ACCATTAAATATTTTTCTTCTTTTTTCAAATTTCTTTAATTTATAACTGTAGGTATTTCT
TGCTTAGGATAAGTTTTCACGTGAAAATTATGCAATAAAAGTTATAACTAAAGACAAGTT
ATTATAGTAAACAAAGGGAATTGTAAAATATTTTTTTTTAAAGTTTTAAAACTTAATAAT
TACTTAAAAAAGCAAAGAAAATTTATTAAATGATTTATTTGTTTGTAAAAAAAAAGAAAT
CTCTGCTTAACGAAATATAGATAATGAAAGAACTTGATAATGTAAATGGATGTCTTAAAT
TAATTGGTGTTTACGAAACAGACAGCTCTGTAAATCTGATCTTAGAATATATCAAAGGTG
GTGAGCTAGTAAAAAAAATAAAATTAAAAGACAAATAAAACTTTACTATAGAAAATATGA
GATAACTTATGTAAAATATACTGATTGCCCTTGCACATATACATCAAAGAAAGATTATCC
ACAGAGATTTAAAACCAGATAATATCCTAATTGAAGATGATATTAATTCTACTAAAATAA
AAATAGCTGATTTTGGCCTAGCTACTTATGATAGTACTGTATTAAATGATTTTTTATTTA
AAAAATGTGGTACTCCTGGTTTCTTAGCTCCAGAAGTTCTTTCAAACAAAGATACACATA
AACTATATGACCATAAAGTGGATGTCTTTAGTGCTGGCGTTATTTTTTACATACTGTAAA
CAAATTTTGCTTTCTTGAATTTCCTTTAATTAATATAAAATTTAATGATAATAAACATAG
ATTATGTGGTCAATAACCTTTCAAAGGAAGCAATCACAGATAAGTAGTTGAGTAAAATAA
AAAATGTGAAATTGATTTTTAAATACTGGATTCAAATTAAAAAATCCCTTAAGCAGGTAA
AGAAATTTGATTAATCAATTAATAATAATATATCTGTGTTTAATCCAAATAAACACATAT
TTATTTGTTCCCTTTTTAATAAATAAATTTTAGAAAAAAATTAACAAAAACTATTCCAAT
CATAAATCTACCACAAAAAAGATAGAATTTTAGATAAATTAAATTAATATTTTTAATAAT
AATTAATTGTCTAAAAGAGAAATAAAAGTCTATTTCATAAATGATGTTATTTTACATCCT
CTAATATTTAAAGAATTTAACTTTTTTACTGTTTGCAAATATAAAATGCATCAACTTTAT
TTAAGTTAAATATTTATTAAAAAACATCAATTTTATTTAAGTTAAATTCTTAGCATCAAT
TTTATTTATTTGAGTTTAATATTTATCAATAAGCATCAATTTTATTTATTTGAGTTTAAT
ATTTATTAAAAAGCATAAATTTTATTTAAGTTAAATTCTTAGCATCAATTTTATTTATTT
GAGTTTAATATTTATCAATAAGCATCAATTTTATTTATTTGAGTTTAATATTTATTAAAA
AGCATAAATTTTATTTAACTTAAATATTAAAAAAAACTCAATTAAATTTATTTTTTTACA
CAATTCATCCCTCATATATTAATGCATTCATTTTATAGCTTAAAATTTTATTTTCTCTAT
TTTATTTATTTGAATTTAATATTTATAAAAAAGTATAAATTTAATTAAATTTTACATTTT
CTAAAATTAAATTTTTTATTTTTCAAAACTTAACAGCTAAAATTTTGGTAAAGTAAATGT
TAGCTAAAGACCCTATCAATAGACCTACATCGCAAGAGTGTCTTAACAGCCCATTCTTTA
AAGAAAATATCATCAATAACTCTCTTCACTTCGATTTACATAACTACGAAAATTAAAAGT
ATGAAATAGTTTTATTCATTTAAAATAATTATCAATCAAATCTTTTCTATTTTAATCTTA
TTAAAAAAACTATTAATTAGAAATAATTTTATAAATAATAAAATATTTAATTATTTGGCT
TACCTAAAATGATACATTTTAAAAAAATATTAGATTATAATCATTAGATGGACTTAATAG
ACTTAAAATAGATTCTTTAGATAAGAATTCTTAAAATGATTTGTATTGGGTTAATCCTGT
GTGGAAAGGCTAGACAAATACTGTTTAAACAGTGACAAAGCTATCTTCAATATACTTGTA
AATAAATGATGTTAGAAAAAGAAATAAAAGCAACTTTGCTCCTATAAATGTTCATGCTGA
GGAAAGTAAAGATGATGATAGTGGAATAGCTAGCTCTGTTAGAGAAAAAAGAAGTGCCAG
TGCTGATTGCGATTTCAGAAATAAATATTTGCAAAATCAGAGTCTTCATATAACAGTGTT
AAAGAAGTAAAAATAAGGAGATGAATAAACAAACAATGATAACCCAGAAGCGTCTATTGA
TAATAATATTGATTGTATAGAAGAAAATTTTGATGTAAGCGGATATGACTTAAAAAATAG
TTTGGACTAATAAGAATAAAATAAAAATGAAGACTAATTTAAATAATAAAATAGTGATTA
TAATAATAACTAATTAAATCTGAAGGCTTCATAATTTAAAAAGAGTCAATTTTTAGATTC
AAACAGGGACGAATACAAACCTAGCATGAAATCTAGTGGATGGGAAAGCATCGAAAATGA
ACCATAAATTAACAAGCAAGGTTTAAATTAAAATAGATTAGAAAACAAATACTCTTTAAA
GCCTTTCCAAAATATGGAGGCGATAAATGTTTAATACCCAACTTTTATGAGCTAAATTTC
TTAAAAGGAGCGTTAAGATGTGAGGCTCAGCAATATCATTTCAGATGAAAAAGTGAATAT
GGATGAAGATTTCTATAATAAGCAATACTCTTCAAATAGAAGCATAGAGTATAATCTAAA
AAAAAATGAAGCACTTGAAAATCATTGCTAAAAAGTAAACCACATCAAAATAAAACTTAG
AGATTTTAATAGCTCAAGTATGTGGTACAACCCAATATAATAAATAGTTGCTGCTCCAAG
TATTCTAAGCAAGGAAAATTAGAATTATAATTCAGAAGCTTTTGAAGACGAACAGCATCA
ATACTACTCAAGGCAAGGGATTAGAAACAGTACATACAATTAGAATAGTTGCCAAGAAGC
CGATTTTAGAGTGAGCGAAGTAGAAGAAAATATAAGTTCAAGGCATTTTACTACAATAAA
TCGTAATCTCATTTTTAGATACAATCCCTTCGACTGCAATGTGTGTTTATGA