Identifiers and Description

Gene Model Identifier

TTHERM_00353420

Standard Name

None

Aliases

PreTt05356 | 36.m00320 | 3703.m00179 | THK1

Description

Protein kinase domain containing protein. Sequence similarity to the DYRK2 protein kinase subfamily (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07196 ) Flagellin hook IN motif
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00353420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09851.19.997093137033517e-262protein kinase domain-containi
ng protein (1180 aa)
OxytrichaContig21921.0.g128.996715803925261e-157Protein kinase domain
WormBaseWBGene000031501.999149254372995e-126locus:mbk-2 status:Confirmed
UniProt:Q9XTF3 protein_id
:CCG28133.1
DictyBaseDDB_G02937502.000127961544401e-120dyrk2 on chromosome: 6 positio
n 3272270 to 3275238
SGDYJL141C3.9983507938127826e-75YAK1 Serine-threonine protein
kinase; component of a glucose
-sensing system that inhibits
growth in response to glucose
availability; upon nutrient de
privation Yak1p phosphorylates
Pop2p to regulate mRNA deaden
ylation, the co-repressor Crf1
p to inhibit transcription of
ribosomal genes, and the stres
s-responsive transcription fac
tors Hsf1p and Msn2p; nuclear
localization negatively regula
ted by the Ras/PKA signaling p
athway in the presence of gluc
ose
Stentor CoeruleusSteCoe_267879.710436457780846e-67

General Information

Paragraph NoGene NameParagraph Text
122TTHERM_00353420Tetrahymena thermophila’s THK1 protein is homologous with protein kinases. It has three domains: Protein kinase domain (E-value = 2.7E-54), Flagellin hook IN motif (E-value = 6.7E-13), and Tyrosine kinase (E-value = 1.30E-93). The first and third domains contain the catalytic function of protein kinases, which phosphorylate proteins. The second domain does not yet have a determined function, but it is located in many flagellar hook proteins. The closest homologs are in Paramecium tetraurelia strain d4-2, a freshwater protest, Ichthyophthirius multifiliis, a freshwater spot disease, and Vitrella brassicaformis CCMP3155. It is possible this protein functions as a tyrosine kinase . Paragraph by Lynnlee Duck-Reynolds and Ann Ly (undergraduates), Keck Science Center, Scripps College.

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00353420(coding)
ATGCAATTTTATAATCCTAACTCATCATCATCTGCATCTAAAAATTCTAACATAAAGGTG
CAATAAAACCTCAATAACTCTCAACTGAATAATGCACTGTCTCCAAAGAAATATAAATAG
AAGAACATATCGTTGGATTTAGGTTCTAGAAAAATATCTCCATTGGATAATAGTTTAAGA
AAAAGGATAGAATATTAGCGTGATAGTAAATAAAGCATTAAGCAGCCAAAGTTAACATTA
AACACAAGCTCTCATAATAACACATGTAATTTAAGTAATAATTAAAGTTTTGCTTAAAGT
ACAAAGCACTACTAAGGTAATTCTTCGATTCACATATCTGGTGAAAAGACTCTAACCTAG
CCTAATGTGAATCCATCTGGCGGAATAAATACAAATACAGCAAGCAATGTGAATAATAGC
AACAGTTTAATCATAAACCATATCCTTGACTCCACTAAAAGTCAAGGTGGGACAATCAAT
ATAAATGCAAACAATATATCGTTTCATAATTAATACAACATAACTAATTTAGTGTCTTAA
ATGAATAGAAAAAGATAGCCTATTGGAGGAAATGTGATAGTAAATAATAGTGTTGGATAA
AATACAATGATTTCGAATAATATAAATTAATTAAGTGCAAATGTATAAAATCTTAACAAC
ATCCTAAATTATTAAAACAGTGGAGCTTCTACTGCAACTAACAGCAACGCACCTAGAAGC
ATATAATTTCATTAATATGGTGCACCAAATTCTACAAATAAAGTTAATAGCAGTTTTAAT
TAGTTCAATTAAGGAGGTTAAACAAATAATTTTATGAATTTGAGTTCTGTTTCTACCAGT
TAGAATGCTTAAGTAAATAACTCGTAACATATCAACAATAATAATAATGGAAGCAATCCA
ATAAGAAGATCTAAATATAAAATAAACACTGAAACAATTAATACACAAAATGATTATTCT
CTAACGATAGACCACTCTGGAGGTTCTATCCCTCGCTATCCTCAAACGGAAACTCACAAA
ACAGGGACAAAAGAAATAATTATCCCTTAATCAAATAAAATAGAGTAAATTTCTAATAGA
TATAATCTAACTTCTACAAATAAGCCTAACTCTAGAATGCATCTTATGATAGGTACAGAA
AACGATCAATCTTAAAATTAAATGGGAGGATTAAAAGACTTCCTTTCTCCACAAGGTGCA
GCTTTCATAAAATCAAATGTATCAAGTAAGAGCACTTAAAGAAATTACTCAAATAAAAAT
AGATACTTAGGTTTAAATAAAATACAAGCTCAATAATAAAACTCATCTCAATCAAGAGTT
AGAAGTAATATAAAATAAATGAGCAAAGATAAAGCACTTTCAGTAGATAAAACCTCTAAT
TACATAAATCGTCGTGACTCTACTTAAAATTAAAATGGAAATTATATTCAAGATAAGTCT
TCATTATTGTAAACATTATAGCCTCCAGCATCTCAAAGCTATGACCAAGGAGGAGATAAT
GCTTACTATAAACATAATACTTTGTAAGATGAGCAACTAGGAAGCACATATTATACAATA
GATAATTAAAACTTGCAATAACCTACAATTTAGTCTTCAGGTAGCTCTAAATTAGAAGAA
AAGCATTTAACTTGGGAAGATCTTAAACTCCCTGTAGGTCCTGATGATGTCTTAAACAAG
TATGGACATGAATTCCTCACAGATTATGAAAAAAAAGAAATATTATAATACATGAATATT
TATTATGTAGGTCACAAGGCCAAAAAACCAGCTAGATCAGAAATCTAATAAGCTAATTCA
TACAATTTCGGATATGATGATGAAAAAGGAGACTATCTTTATACATTAAATGATCACATT
GCTTACAGATATGAGCTGATTGAGGCTTTGGGTAAGGGATCTTTTGGACAGGTTATAAAA
GTGTTTGATCATAAAAGAAAAGAATACTCAGCTTTGAAAATTATAAGAAATAAAAAGAAT
TTTTATAATTAAGCAATTGTAGAACTAAATATATTAAAATATATAAAAGACAACGACCCT
TAAAATTAAACGAATATTGTTAAAATTAAAGACTTTGTGATATTTAGGAGCCATGTGTGT
ATTGTTTTCGAGCTACTTAGTATCAATCTTTATGAATTTTTGAAGAATAATAAATTTAAT
GGGGTTTCTTTAGAACTGATCAGGAGGTTTGCTATTTAAATTTTATAGGGATTGCTTTTT
TTAACAAAAGCGAATATTATTCATTGTGATTTGAAACCAGAAAATATTTTACTTAAGCAG
GAAAATAAATCAGGTATTAAGATTGTTGATTTTGGATCAAGCTGCTTTGAGAACTAGAGA
GTTTATACTTATATTCAAAGCAGGTTTTATAGAGCTCCCGAAATTATTTTAGGCTTACCC
TATGGAAAGGCTATAGACATGTGGAGCTTTGGGTGTATTATGGCTGAGCTGTATATTGGT
TATCCTTTATTTCCTGGGGAGAACGAAGCTGAATAATTTTAAATGTTTATGGAGATACTA
GGAATACCAGAAGAAGAATTTGTTGAAAATTGTCCTAGGAGAAATGTGTTTTTTGAAAAT
AATAAAACACCTAAAGTTGTCAAAAATTCTAGAGGTAAAATAAGAACTCCAGCTACTAAG
CACATAAATTACTATCTCCGCTGTCCTGATGAAAATTTTATTGATTTTGTTTCAAAGTGC
TTTACTTGGAAAAATCACGAAAGAATGTCGCCTGCTGAAGCCCTCGTTCACGATTGGATT
TTAGAAGGATTGCCAGAGGAAATCAGGGCTTAGCATCTATAATAAATGCAACAAACATCT
CCTGAAATAGACATGAGAGCTAAATTTAAAAAATATAAAATTGCATGGATTCCTCCTCCA
AATCTCCAAGTATTTAAAGGAAAAATTCCCTCAGCTCCTCCTTAACAACAATATTCAAAT
AAACAAGCAAAATCACAATCCAGTAATAAAGCAAATACGATTGAAGATTAACCTTAAAAT
AATGAAAATACAAGTGGAGTTGGATAAGGGAGAAATAGCTTTAAAAAGGCTGAAATGAAT
AACTCAAGCAGCTTTGGACCTTCAGTGGTAAGCGTAAATACTGGCCTTTAAGAGAGAAAT
AAAAATATAATTAATTCGCAGTCTCATCAAATATAAGATGTAAAGATAAATCCATAATCT
TAAGCGAGTAATCCTTCTTCATCTTCTTGCTAAAATGCGATAAATAAATATGGATAAAAA
TAAAATAATGCAAAAAATTATGTTTTTAAAAATTAAAATCCACTAAATAGTGTTACAAAT
AATTAACCTCTATCTCAATCTAAGATCGAATAAGCTGAAAACCCTTCTTCAAATAATCTT
TCATAAATTCCATTAAATTAAGGAATATCTTTATAAAATAATAAAAAGAAGACAGACATG
ATACACTTAAGTGATTTTAATCCATATGAATCTGATCAATTTTCAAATACATTTTCTGCA
GCGACAACAACAAATGCCAAAAAAACTTAACAATAATTTGGATTTGTGCAAAATAACACT
CCTTAGCATCAAAATTTAAACGGAATTAAAGCAAATAATTTCCTTTAGCAAGGAAATTCT
TAGAACCAATCAATTTACCCAAATTAAATTAAAATAAGAAGACCTGATTCTTCCAAAAAA
AATAAAATAGAATAAAATTTTGTTGCTAATGAAGATCTGTAAAAAAACTCAAATCTCCAA
ATACAAAGTGGGGAAAATTGA


>TTHERM_00353420(protein)
MQFYNPNSSSSASKNSNIKVQQNLNNSQLNNALSPKKYKQKNISLDLGSRKISPLDNSLR
KRIEYQRDSKQSIKQPKLTLNTSSHNNTCNLSNNQSFAQSTKHYQGNSSIHISGEKTLTQ
PNVNPSGGINTNTASNVNNSNSLIINHILDSTKSQGGTININANNISFHNQYNITNLVSQ
MNRKRQPIGGNVIVNNSVGQNTMISNNINQLSANVQNLNNILNYQNSGASTATNSNAPRS
IQFHQYGAPNSTNKVNSSFNQFNQGGQTNNFMNLSSVSTSQNAQVNNSQHINNNNNGSNP
IRRSKYKINTETINTQNDYSLTIDHSGGSIPRYPQTETHKTGTKEIIIPQSNKIEQISNR
YNLTSTNKPNSRMHLMIGTENDQSQNQMGGLKDFLSPQGAAFIKSNVSSKSTQRNYSNKN
RYLGLNKIQAQQQNSSQSRVRSNIKQMSKDKALSVDKTSNYINRRDSTQNQNGNYIQDKS
SLLQTLQPPASQSYDQGGDNAYYKHNTLQDEQLGSTYYTIDNQNLQQPTIQSSGSSKLEE
KHLTWEDLKLPVGPDDVLNKYGHEFLTDYEKKEILQYMNIYYVGHKAKKPARSEIQQANS
YNFGYDDEKGDYLYTLNDHIAYRYELIEALGKGSFGQVIKVFDHKRKEYSALKIIRNKKN
FYNQAIVELNILKYIKDNDPQNQTNIVKIKDFVIFRSHVCIVFELLSINLYEFLKNNKFN
GVSLELIRRFAIQILQGLLFLTKANIIHCDLKPENILLKQENKSGIKIVDFGSSCFENQR
VYTYIQSRFYRAPEIILGLPYGKAIDMWSFGCIMAELYIGYPLFPGENEAEQFQMFMEIL
GIPEEEFVENCPRRNVFFENNKTPKVVKNSRGKIRTPATKHINYYLRCPDENFIDFVSKC
FTWKNHERMSPAEALVHDWILEGLPEEIRAQHLQQMQQTSPEIDMRAKFKKYKIAWIPPP
NLQVFKGKIPSAPPQQQYSNKQAKSQSSNKANTIEDQPQNNENTSGVGQGRNSFKKAEMN
NSSSFGPSVVSVNTGLQERNKNIINSQSHQIQDVKINPQSQASNPSSSSCQNAINKYGQK
QNNAKNYVFKNQNPLNSVTNNQPLSQSKIEQAENPSSNNLSQIPLNQGISLQNNKKKTDM
IHLSDFNPYESDQFSNTFSAATTTNAKKTQQQFGFVQNNTPQHQNLNGIKANNFLQQGNS
QNQSIYPNQIKIRRPDSSKKNKIEQNFVANEDLQKNSNLQIQSGEN


>TTHERM_00353420(gene)
ATGCAATTTTATAATCCTAACTCATCATCATCTGCATCTAAAAATTCTAACATAAAGGTG
CAATAAAACCTCAATAACTCTCAACTGAATAATGCACTGTCTCCAAAGGTAAATCTTAGT
TTGTTTCATAAAATCAAAGCTTACATAAAATATTTTAAGTTGCAGATTAATTACTATTAA
TACTTTATAATAGTTGATCTTATTAGCGGTTGCCTTTTCTTATTAAAGAGGAAATTTTTA
TCAATAATCGTTAAAATACATTTTAATCTGAAATAGCAAATTAATGCATTGATTTATATG
TAATAATTTTTGATTTTTTTTGTTTAAAGAAATATAAATAGAAGAACATATCGTTGGATT
TAGGTTCTAGAAAAATATCTCCATTGGATAATAGTTTAAGAAAAAGGATAGAATATTAGC
GTGATAGTAAATAAAGCATTAAGCAGCCAAAGTTAACATTAAACACAAGCTCTCATAATA
ACACATGTAATTTAAGTAATAATTAAAGTTTTGCTTAAAGTACAAAGCACTACTAAGGTA
ATTCTTCGATTCACATATCTGGTGAAAAGACTCTAACCTAGCCTAATGTGAATCCATCTG
GCGGAATAAATACAAATACAGCAAGCAATGTGAATAATAGCAACAGTTTAATCATAAACC
ATATCCTTGACTCCACTAAAAGTCAAGGTGGGACAATCAATATAAATGCAAACAATATAT
CGTTTCATAATTAATACAACATAACTAATTTAGTGTCTTAAATGAATAGAAAAAGATAGC
CTATTGGAGGAAATGTGATAGTAAATAATAGTGTTGGATAAAATACAATGATTTCGAATA
ATATAAATTAATTAAGTGCAAATGTATAAAATCTTAACAACATCCTAAATTATTAAAACA
GTGGAGCTTCTACTGCAACTAACAGCAACGCACCTAGAAGCATATAATTTCATTAATATG
GTGCACCAAATTCTACAAATAAAGTTAATAGCAGTTTTAATTAGTTCAATTAAGGAGGTT
AAACAAATAATTTTATGAATTTGAGTTCTGTTTCTACCAGTTAGAATGCTTAAGTAAATA
ACTCGTAACATATCAACAATAATAATAATGGAAGCAATCCAATAAGAAGATCTAAATATA
AAATAAACACTGAAACAATTAATACACAAAATGATTATTCTCTAACGATAGACCACTCTG
GAGGTTCTATCCCTCGCTATCCTCAAACGGTAAAAATTAAATTTTTGATTTACAAATAAA
AAGCAGCAATTTTTTTTTGCTAATAAGATAGAAAGATATAACTAAAAACTAAATAATTTT
ATTGGTAATTTTTATAGTACTAAATAAATTTGATTCTTAATATGTTAAGATAGTGTAAAA
GAAAAACAAACTAAGAAAATATTACTCTAACGAATAAACTATTTACTTCAATAATCATTA
TTTATTAAAATAATAAAATATATATAAAAATATTTAAATTAAAAAACTATCAATTAATTT
CTATCTGCTGTAAATTTGATATAAGATTATTTATTTTTTTGATTAATTTTAACGAATTTC
TCTTATTAATTTAAATAGGAAACTCACAAAACAGGGACAAAAGAAATAATTATCCCTTAA
TCAAATAAAATAGAGTAAATTTCTAATAGATATAATCTAACTTCTACAAATAAGCCTAAC
TCTAGAATGCATCTTATGATAGGTACAGAAAACGATCAATCTTAAAATTAAATGGGAGGA
TTAAAAGGTAGTTTATGATTTAAACATTTTATAGCTATTACTATTCCAAATTAATTTAAA
ATTTCATTACAAAGATAAGTATTTTTTGATATTTTAAGTGAATTAAATAATACTTTAATT
TAATTAAATTAAACAAACAATAAAATTTTAATAAAAAATTATATTATAATATAGACTTCC
TTTCTCCACAAGGTGCAGCTTTCATAAAATCAAATGTATCAAGTAAGAGCACTTAAAGAA
ATTACTCAAATAAAAATAGATACTTAGGTTTAAATAAAATACAAGCTCAATAATAAAACT
CATCTCAATCAAGAGTTAGAAGTAATATAAAATAAATGAGCAAAGATAAAGCACTTTCAG
TAGATAAAACCTCTAATTACATAAATCGTCGTGACTCTACTTAAAATTAAAATGGAAATT
ATATTCAAGATAAGTCTTCATTATTGTAAACATTATAGCCTCCAGCATCTCAAAGCTATG
ACCAAGGAGGAGATAATGCTTACTATAAACATAATACTTTGTAAGATGAGCAACTAGGAA
GCACATATTATACAATAGATAATTAAAACTTGCAATAACCTACAATTTAGTCTTCAGGTA
GCTCTAAATTAGAAGAAAAGCATTTAACTTGGGAAGATCTTAAACTCCCTGTAGGTCCTG
ATGATGTCTTAAACAAGTATGGACATGAATTCCTCACAGATTATGAAAAAAAAGAAATAT
TATAATACATGAATATTTATTATGTAGGTCACAAGGCCAAAAAACCAGCTAGATCAGAAA
TCTAATAAGCTAATTCATACAATTTCGGATATGATGATGAAAAGTAAAATAAAATAAAAT
TCAAGTTTTTACTTTTTTACAATAAATTTGTATTTGAATTTCTAATTTATTGTAAATTTA
TTTTATTAACTTCCAAATAAATAAATGAGCTCAATTACTATTAAAATTGAATTATAAAAT
TTAAAATATCAACATTTTATTTACTTCATCAAATCGATAATAAAAAATATTTAATTAATT
AATTTCGTAAAATTTAGTTTATTTTGTTAGATTAAAAATACTAAAAATATTTGATAAGAG
TATGATTTAATAATGAGTCTTTAAAAATATTATTTAATAATAAAAAGAGGAGACTATCTT
TATACATTAAATGATCACATTGCTTACAGATATGAGCTGATTGAGGCTTTGGGTAAGGGA
TCTTTTGGACAGGTTATAAAAGTGTTTGATCATAAAAGAAAAGAATACTCAGCTTTGAAA
ATTATAAGAAATAAAAAGAATTTTTATAATTAAGCAATTGTAGAACTAAATATATTAAAA
TATATAAAAGACAACGACCCTTAAAATTAAACGAATATTGTTAAAATTAAAGACTTTGTG
ATATTTAGGAGCCATGTGGTAATCAATCAATCATTTATTTTATTAAAATTATTTATTTAG
AGATTTATTTAGTGACATATATAGATTAATTTTAACTTCTACTTTGAATAAATCTAAATT
TTTTATTTTTAAATAAAGTGTATTGTTTTCGAGCTACTTAGTATCAATCTTTATGAATTT
TTGAAGAATAATAAATTTAATGGGGTTTCTTTAGAACTGATCAGGAGGTTTGCTATTTAA
ATTTTATAGGGATTGCTTTTTTTAACAAAAGCGAATATTATTCATTGTGATTTGAAACCA
GAAAATATTTTACTTAAGCAGGAAAATAAATCAGGTATTAAGATTGTTGATTTTGGATCA
AGCTGCTTTGAGAACTAGAGAGTTTATACTTATATTCAAAGCAGGTTTTATAGAGCTCCC
GAAATTATTTTAGGCTTACCCTATGGAAAGGCTATAGACATGTGGAGCTTTGGGTGTATT
ATGGCTGAGCTGTATATTGGTAATTAAACCATTTAAAAATCAAACCATTTTTTAAATTAA
AAAATTAATACTTCAAAAGGTTATCCTTTATTTCCTGGGGAGAACGAAGCTGAATAATTT
TAAATGTTTATGGAGATACTAGGAATACCAGAAGAAGAATTTGTTGAAGTAAATTTTTAT
TTGATAAAAGTCAAGTAAATATATAAGTTATTTAATTAAATAAACATTTTTTAAAAATAA
GAATTGTCCTAGGAGAAATGTGTTTTTTGAAAATAATAAAACACCTAAAGTTGTCAAAAA
TTCTAGAGGTAAAATAAGAACTCCAGCTACTAAGCACATAAATTACTATCTCCGCTGTCC
TGATGAAAATTTTATTGATTTTGTTTCAAAGTGCTTTACTTGGAAAAATCACGAAAGAAT
GTCGCCTGCTGAAGCCCTCGTTCACGATTGGATTTTAGAAGGATTGCCAGAGGAAATCAG
GGCTTAGCATCTATAATAAATGCAACAAACATCTCCTGAAATAGACATGAGAGCTAAATT
TAAAAAATATAAAATTGCATGGATTCCTCCTCCAAATCTCCAAGTATTTAAAGGAAAAAT
TCCCTCAGCTCCTCCTTAACAACAATATTCAAATAAAGTAAATATAAAATAATTTTTTAT
TCAATATTAATGTATTTTCATAACTATATTAGCAAGCAAAATCACAATCCAGTAATAAAG
CAAATACGATTGAAGATTAACCTTAAAATAATGAAAATACAAGTGGAGTTGGATAAGGGA
GAAATAGCTTTAAAAAGGCTGAAATGAATAACTCAAGCAGCTTTGGACCTTCAGTGGTAA
GCGTAAATACTGGCCTTTAAGAGAGAAATAAAAATATAATTAATTCGCAGTCTCATCAAA
TATAAGATGTAAAGATAAATCCATAATCTTAAGCGAGTAATCCTTCTTCATCTTCTTGCT
AAAATGCGATAAATAAATATGGATAAAAATAAAATAATGCAAAAAATTATGTTTTTAAAA
ATTAAAATCCACTAAATAGTGTTACAAATAATTAACCTCTATCTCAATCTAAGATCGAAT
AAGCTGAAAACCCTTCTTCAAATAATCTTTCATAAATTCCATTAAATTAAGGAATATCTT
TATAAAATAATAAAAAGAAGACAGACATGATACACTTAAGTGATTTTAATCCATATGAAT
CTGATCAATTTTCAAATACATTTTCTGCAGCGACAACAACAAATGCCAAAAAAAGTAAAA
TCACTAGTATTATTTATAATTTATCAAATTAAATCTTCCATTTTATTTAAAAGCTTAACA
ATAATTTGGATTTGTGCAAAATAACACTCCTTAGCATCAAAATTTAAACGGAATTAAAGC
AAATAATTTCCTTTAGCAAGGAAATTCTTAGAACCAATCAATTTACCCAAATTAAATTAA
AATAAGAAGACCTGATTCTTCCAAAAAAAATAAAATAGAATAAAATTTTGTTGCTAATGA
AGATCTGTAAAAAAACTCAAATCTCCAAATACAAAGTGGGGAAAATTGA