Identifiers and Description

Gene Model Identifier

TTHERM_00348580

Standard Name

COI7 (Conjugation-induced 7)

Aliases

PreTt05270 | 36.m00234 | 3703.m00096

Description

a gene specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00348580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09767.19.999242092827953e-100hypothetical protein (259 aa)
Stentor CoeruleusSteCoe_120800.00000004139937718785167
OxytrichaContig16339.0.g840.00000005001214305021125Leucine Rich repeats (2 copies
)
WormBaseWBGene000093670.0000009995106777214876Acidic leucine-rich nuclear ph
osphoprotein 32-related protei
n 1 status:Confirmed UniPr
ot:O62220 protein_id:CAB0426
5.1
DictyBaseDDB_G02904210.000005998506718272351DDB_G0290421 on chromosome: 5
position 4063431 to 4065691

General Information

Paragraph NoGene NameParagraph Text
115COI6,
JMJ1,
LIA5,
COI7
Coi6p, its interaction partners Coi7p and Lia5p, and the histone demethylase Jmj1p are crucial for confining the production of small RNAs and the formation of heterochromatin to the eliminated sequences. The loss of Coi6p, Coi7p or Jmj1p causes ectopic DNA elimination.
114COI7,
COI6
Coi7p directly interacts with Coi6p and is required for the stable accumulation of Coi6p.

Associated Literature

  1. Ref:28273462: Suhren JH, Noto T, Kataoka K, Gao S, Liu Y, Mochizuki K (2017) Negative Regulators of an RNAi-Heterochromatin Positive Feedback Loop Safeguard Somatic Genome Integrity in Tetrahymena. Cell reports 18(10):2494-2507
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00348580(coding)
ATGGAATTACTAGATTCAGATATAGGCTCTCAAATAAATTAGTAGGTTGAAGGAAAAAAT
TTTAAAGAAGTGGAGGATATCTATTTACAAAATATACAATCTGCTAAATTCACCTCGGAA
TACAGAGAAAAAATTTAATCTTTCCCAAATTTAATATGCTTTAGCCTCACTAACATGAAT
TTCAGCAAAATATAAGATCTTCCTATTTTAAAGAGACTGCTAAGATTAGAGATATGTTAT
TGCACCTTCGATATCAGTAGTCTCAATTAAATTTACATTTAATTTCCAAGGCTTGTGAGT
TTAAGGCTAGTTGGATGTAATATTAGCTCATATTCATAAATTGAATGTTTAACAAGCTTG
CCAGACTTGGCCTAATTAGATCTATTTAATAATCCTATTTACAAATTTAATTACGAATAT
CAGAGCTTTCATTAAAAAATGTTCGAATTATTTCCTAAATTGATGTATTTGGACAATCTT
AAAAAAGATTTCTCAAGAGCTTGTACCATTCCTATAAATTAGATTGATCCAAAATAACTT
ATTCAAGAAGTTGAAATCCCTAAATTTGTAGATAAACTCAACAGATCAAACATAAACTCT
TAGAATAATAGTTTTAATTCTAATAAATTGACACGTAAAAATAATATTAACAATCCAAAC
AAAAGAAGGGCTGACAATTCAGACGAAGAGGATGATGACCTTGATGAAGATTACCAAGAA
GATAGTGATGAACCATCAAATCAAAGACATGGCTATCAAACTAGAAAATAATAGAAATTA
GCTGCATACAAATGA


>TTHERM_00348580(protein)
MELLDSDIGSQINQQVEGKNFKEVEDIYLQNIQSAKFTSEYREKIQSFPNLICFSLTNMN
FSKIQDLPILKRLLRLEICYCTFDISSLNQIYIQFPRLVSLRLVGCNISSYSQIECLTSL
PDLAQLDLFNNPIYKFNYEYQSFHQKMFELFPKLMYLDNLKKDFSRACTIPINQIDPKQL
IQEVEIPKFVDKLNRSNINSQNNSFNSNKLTRKNNINNPNKRRADNSDEEDDDLDEDYQE
DSDEPSNQRHGYQTRKQQKLAAYK


>TTHERM_00348580(gene)
ATGGAATTACTAGATTCAGATATAGGCTCTCAAATAAATTAGTAGGTTGAAGGAAAAAAT
TTTAAAGAAGTGGAGGATATCTATTTACAAAATATACAATCTGCTAAATTCACCTCGGAA
TACAGAGAAAAAATTTAATCTTTCCCAAATTTAATATGCTTTAGCCTCACTAACATGAAT
TTCAGCAAAATATAAGATCTTCCTATTTTAAAGAGACTGCTAAGATTAGAGATATGTTAT
TGCACCTTCGATATCAGTAGTCTCAATTAAATTTACATTTAATTTCCAAGGCTTGTGAGT
TTAAGGCTAGTTGGATGTAATATTAGCTCATATTCATAAATTGAATGTTTAACAAGCTTG
CCAGACTTGGCCTAATTAGATCTATTTAATAATCCTATTTACAAATTTAATTACGAATAT
CAGAGCTTTCATTAAAAAATGTTCGAATTATTTCCTAAATTGATGTATTTGGACAATCTT
AAAAAAGATTTCTCAAGAGCTTGTACCATTCCTATAAATTAGATTGATCCAAAATAACTT
ATTCAAGAAGTTGAAATCCCTAAATTTGTAGATAAACTCAACAGATCAAACATAAACTCT
TAGAATAATAGTTTTAATTCTAATAAATTGACACGTAAAAATAATATTAACAATCCAAAC
AAAAGAAGGGCTGACAATTCAGACGAAGAGGATGATGACCTTGATGAAGATTACCAAGAA
GATAGTGATGAACCATCAAATCAAAGACATGGCTATCAAACTAGAAAATAATAGAAATTA
GCTGCATACAAATGA