Identifiers and Description

Gene Model Identifier

TTHERM_00348490

Standard Name

None

Aliases

PreTt05261 | 36.m00225 | 3703.m00087

Description

MIZ zinc finger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00628 ) PHD-finger
  • ( PF07813 ) LTXXQ motif
  • ( PF02891 ) MIZ/SP-RING zinc finger
  • ( PF01394 ) Clathrin propeller repeat
  • ( PF09322 ) Domain of unknown function (DUF1979)
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00348490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09760.19.997093137033517e-262hypothetical protein (1619 aa)
OxytrichaContig20338.0.g799.995317835403734e-19MIZ/SP-RING zinc finger
Stentor CoeruleusSteCoe_66730.00000000000003442477108469977
WormBaseWBGene000015740.000000000029994712494008525locus:gei-17 E3 SUMO-protein
ligase gei-17 status:Confir
med UniProt:Q94361 protein
_id:CAB02133.4
SGDYOR156C0.00000000030007160092483236NFI1 SUMO E3 ligase, catalyzes
the covalent attachment of SU
MO (Smt3p) to proteins; primar
y E3 ligase for Sir4p; sumoyla
tes Yku70p/Yku80p and Sir4p in
vivo to promote chromatin anc
horing; promotes telomere anch
oring to the nuclear envelope;
involved in maintenance of pr
oper telomere length

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892853: Hamilton EP, Kapusta A, Huvos PE, Bidwell SL, Zafar N, Tang H, Hadjithomas M, Krishnakumar V, Badger JH, Caler EV, Russ C, Zeng Q, Fan L, Levin JZ, Shea T, Young SK, Hegarty R, Daza R, Gujja S, Wortman JR, Birren BW, Nusbaum C, Thomas J, Carey CM, Pritham EJ, Feschotte C, Noto T, Mochizuki K, Papazyan R, Taverna SD, Dear PH, Cassidy-Hanley DM, Xiong J, Miao W, Orias E, Coyne RS (2016) Structure of the germline genome of Tetrahymena thermophila and relationship to the massivel
  2. Ref:22384362: Fass JN, Joshi NA, Couvillion MT, Bowen J, Gorovsky MA, Hamilton EP, Orias E, Hong K, Coyne RS, Eisen JA, Chalker DL, Lin D, Collins K (2011) Genome-Scale Analysis of Programmed DNA Elimination Sites in Tetrahymena thermophila. G3 (Bethesda, Md.) 1(6):515-22

Sequences

>TTHERM_00348490(coding)
ATGATAGATTAGAATATACAAAAATTGGATATGGATAACTTTTACTTAAAAATAATGAAA
GCAGGAATTGTTTAGTTTAAGCTTGAAAAATCAGAGAGAGCTTAAATCTGGTAAGATTTA
GCTAAGAAGGGGAAAATAAGTAAGCAATAGGCGCAAGGAGAAGCTGAACTTGCTAAAGAA
TTAGTAGAGTTCTACTTAAAACATCCTGAAAGAGATGGTTAGGCAAAGTAACTAAGTGAG
TATTTTAATAAAAATGTGCAGGTGAAAGTTGAAGGAATTTTTAAATATTATATCGAAAAC
GCTATAAAGCCATAATAATAGTAAGAGGCAAAAATGAAGAGCGATTATAGTAATGCCGCC
TTCTATCAGCAATAACAACAACAACAACAATATGATGCATAACAACTAAAATACTTGCAG
TAAATGAATTACGGTAATACTTCGAGCTTAATGGGAATGTCTATGGCTTCAATGCCTACA
AATTAAACTCCATTCTTACAATATAATCCTAGTGTGATGAATCCTCTTTTTAACAGCTTA
TCTTTTTAGTAAAGCACTCCAACTGAAAGCCTTGGCTTACCATACGGATATTTTCAACTT
CCTAATTAATTTATGCATCCTTAAAGTAATTAAGGAGTGCCTTAGCTACAGCAAACTTAT
ATGTATAACAAGCCTCATGATATTTCTGGTATTAATACTGCTGCTTATACGACTACTCCT
TAAAGCTACATAAATTCACTAAATTTAGGATAATAAGTTGGGTTCGTAAACTCTCTTCCA
TAGAGCCTTTATGGTTCTCAATTTATTAACTAATAATAGGCTGCAGAAGCTGCAGCGACT
TAGACTTAAATTGATTCTTCAAGAAACTTTAATAACTATTTCAATAATATTAATGGTTTT
GCTAAGGGAGCTGAAAATACTTAATATCAAGTTGACTAGCTTATGCAAATTTAAGCTGCT
AATCAGCCTTAATAACAAAAGATTGTTTAGACTTAAAAATAAATCCAAGCGCCTTATTCC
CTTCAAAATTAATAATAATAATAATTTTAAATTTCGTAATAATATTAGTAATAAGCATAG
TTACCTCAATAACAATAATTATAAGCATAAAGCCAACAGAGGTAAACAGCTCAACCTGCA
GCTTCAAAATAAAAGTAGTAGACATCTAGCAGTAGCACTCTTCCCAACATATCTTAACCT
AATCAACCTTTCGGTTTAGCAATAAGCGGAAGTAGCAATAAACAAGTTTAGTCAGCTGCG
AATAATTCGTCATCAAATAAGAGCTCAAAGCTTGGAGTATCTGAAATAACACCCTAAAAT
TAGAAGCAATCATCTAGTTCATCTAGCTCAAAGTCAAAATCTAAGTCCAGCAATAATAGC
AGCGCAATTAACTTGCTGTAATAAACTTAAATACCAATGAACAACACTTATAATGTGTAT
CCACAAAACAGGAATGGAGCAATCCCAAATTAAGTAAAAATAATAGAAACAGAAGCAATC
AAAAGCTGTATTTGCGCTTAAGTACCACGTTTGCGCAATTCCTAATCAGAATTAATTTAG
TGTAAGAATAAAGGATGTGAACACAAACTGCATCTAAGCTGTATGAGGATTTCACCTAAA
GATGAAGAAAGCATTACCCAATTTGAATGCCCTTCCTGCATATTAAAAAAGTATGATCCT
CTCCATCATGTCGAACAAACTTTGATAGATTGCTAAGTAATGATGGGTATTCCCAATAAG
TAGCTTGATTTTTAGTTAACTACAGAGATGTTTACAAAAATAAAAGATCACAGCGAGTAT
TCCGTAGAAATTCGTTGCATCCGAATAGATGGAACCAAAAATATATACGAAACAACTTGG
CCAGATTTTGGTAATTTGAGAATGAATAATGAAGTCATATTAGAACTCAAACCCCTCCAA
AATAATAGCTCACTTAAAAAGCGTAAAGACGAAAAGCATACTTTTAAAGGAGTTAAGAAT
CTAAAAGAAGGAATAAATCACCTTCAAATATCAGAATTCAATTGCAATATAATTGAAAAG
TAGTAATTGCGTATAACAGAAAACTCCCTTCATTGCATTTCCGTCTTTATTATACGTAGA
CTCACTGTAGATTAGCTAGTTTCTAATATAAGAAGAGAATCTACCCGTCCTGCTGATGAG
TGTAAGCAATAAATCTAAGACTACTTCCATCGCCAAAACAAGAAATCTTCCCACGAAGAA
GATGATGATGATCTCTGCATTGACAGTCTGAGTGTCCCTCTAACTTGTAGCTTAGATATG
AAACTCATATAAACACCTGCAAAAGGTCGTTTTTGCAAGCATTTCTAATGCTTTTCTCTT
GAAAACTTCATCATCACCACAGAAACAGTGAATCCTCGTAAATGGAAGTGCAATATCTGC
AAGGCTAAATGCTACGACATCATTATTGATGAATATATTCTTAAAATTATCTAAGAAATA
AATGAAAAGTAAATTAAGAATGTGACTGATGTCAAATTCGATGGTAAAGGTTAGTACTCC
TTTGATCAATAGTCATATTCAGATGATGACGATGACTACGATGATGATTCCAAGCCAATA
GTTAAGAAGCCTTCATAAAATTAAGCAAGTGCTCCAGCTCCTGCAGCCGCATAGCCTATT
ACTGTATCTCCCACTAATTCAAACTAAGCTGTGCCTATCCAATCTGTATAAGCTTAATTG
ATCAATAAAGCTCCTATTAATGGTAACAACAATCCAAAAGGAGTCAATATAGAATCCCAT
TCCAACAGCAATGCTCTTGAATCTTAGTAATTATAAATTTAAGATCAAGTAAGCGGTGGA
AATAAAAAGAAGTCATAACCGCATTAAATTTTAGTTATTGATAGTGATGAAGAGGAGCCT
CCAATATAAAAGAAGGCCTAAACTGTTGCTCCCGCTCCTGCGCAACTTCTTCAATAAGTT
CCTCTCTAAATACAGGCACTTCAATAAAATGGTTAACCTCACCACCACCACCATTTAAAT
ATTCCTTAAAATAATTTTCCTGCAAACGTCCAGAATGGATCTGGCATAAGTATCCATTAA
AATACTAATCTCATGAACCTGAATCAGGCTGCTAGCTTAAATGGAGTTTATTACAAAAAT
TTACAGAACGCCAACTCTCACTAGACATCCAATACAGCTGGGTTAAATACTGTAAATTCA
TAAAATATTAATTAAACGATTACCCTAATTAATAAAGATAAAGATTAATCTTCAAATTAA
TCTTCTAAAAATATTATTACTAAAAGCAAGAAAACCGTAATGTGTGAAGAAGAGAACAAA
GAGACTTCTAAAATATAAAACTAAACAAATAAAAATAACAACAATTAATAAAAAACACCT
TCAAACAACAAAGAGTAGAAATTGAATTCTGAAGAAGTCTAGAGAGAAGTTCAAACAAGT
AGAAATAACGCTGGTAACGCACCATCAAGCACAGCCAGTCTTTCTTCCATGAATGATACT
ACATCTTCAAAAGTGTTTAAAAAGCAAACGGATAAGCAGCAGACAATAGATAAATTATAA
AAATAAAACTATTAATATATTGTTTAAAACGCATAATAATAGATCAATTAAATTTAAGTA
TAACCCAAATAATAAATTAACCCTAAAAGAATAGCATCAAATCAAGACTAGCCAATACTA
ATAGAAAGTCCGAAATCCGATGATCTACATAAAGAAGACACTCTTTAATAAATATCTGTT
TAGAAGTTGTTATAGTAGTAATAGCAGTAACAGCAACAATAAATAATAAATTAAAATGCA
ATGAAGTTAATTAATATGCTATAAATTCCTGAAATTGGAATTAGTAGTTAAGATATTTAA
AAATAGATTCAACTCACAAATAGTTAGAAGCCCTTGATGCTAGATCACATTTAAAAATTG
GAAGAAATATCTATGAGTGGAGACTAAAGCAAGAGCTATCAAAATGTTGTATTGTCAGAT
AAAGAAATACAAAACATTGAAAGGAAGAGAATATAAAAAGAATAGTCTTTAGAATAACGT
CAAGATTTTAGCATTTAATATTTTGAAGATTATATGAGTGCTTAGGGACAAAATATAAGA
TTTGGTAGTTCTTAAGATCTTTCATCCAAGCAAAAATAAAACTTAAACAATAGCACTAGC
GGAAGTAACCAAGGTAGTTCTAAAAAGAGTCAACAAAATCCTCAGGTTAATAACATCATC
GTTAAAACATTAAAAAATTTTGGGTAGTCAGAAACAGTGCAAATTCAATTTGAGTAACCT
TCTGAAAATAGCTTAAAAAGAAAAATCATAGAATAAAATAATTCTAATAGCAGTGAAGGT
CTCAGTAAAAAGAGAATATATGAAAAAATTACCAACATAGGAAAAGAAGATAATCCTATA
ACTATTGATGATTGA


>TTHERM_00348490(protein)
MIDQNIQKLDMDNFYLKIMKAGIVQFKLEKSERAQIWQDLAKKGKISKQQAQGEAELAKE
LVEFYLKHPERDGQAKQLSEYFNKNVQVKVEGIFKYYIENAIKPQQQQEAKMKSDYSNAA
FYQQQQQQQQYDAQQLKYLQQMNYGNTSSLMGMSMASMPTNQTPFLQYNPSVMNPLFNSL
SFQQSTPTESLGLPYGYFQLPNQFMHPQSNQGVPQLQQTYMYNKPHDISGINTAAYTTTP
QSYINSLNLGQQVGFVNSLPQSLYGSQFINQQQAAEAAATQTQIDSSRNFNNYFNNINGF
AKGAENTQYQVDQLMQIQAANQPQQQKIVQTQKQIQAPYSLQNQQQQQFQISQQYQQQAQ
LPQQQQLQAQSQQRQTAQPAASKQKQQTSSSSTLPNISQPNQPFGLAISGSSNKQVQSAA
NNSSSNKSSKLGVSEITPQNQKQSSSSSSSKSKSKSSNNSSAINLLQQTQIPMNNTYNVY
PQNRNGAIPNQVKIIETEAIKSCICAQVPRLRNSQSELIQCKNKGCEHKLHLSCMRISPK
DEESITQFECPSCILKKYDPLHHVEQTLIDCQVMMGIPNKQLDFQLTTEMFTKIKDHSEY
SVEIRCIRIDGTKNIYETTWPDFGNLRMNNEVILELKPLQNNSSLKKRKDEKHTFKGVKN
LKEGINHLQISEFNCNIIEKQQLRITENSLHCISVFIIRRLTVDQLVSNIRRESTRPADE
CKQQIQDYFHRQNKKSSHEEDDDDLCIDSLSVPLTCSLDMKLIQTPAKGRFCKHFQCFSL
ENFIITTETVNPRKWKCNICKAKCYDIIIDEYILKIIQEINEKQIKNVTDVKFDGKGQYS
FDQQSYSDDDDDYDDDSKPIVKKPSQNQASAPAPAAAQPITVSPTNSNQAVPIQSVQAQL
INKAPINGNNNPKGVNIESHSNSNALESQQLQIQDQVSGGNKKKSQPHQILVIDSDEEEP
PIQKKAQTVAPAPAQLLQQVPLQIQALQQNGQPHHHHHLNIPQNNFPANVQNGSGISIHQ
NTNLMNLNQAASLNGVYYKNLQNANSHQTSNTAGLNTVNSQNINQTITLINKDKDQSSNQ
SSKNIITKSKKTVMCEEENKETSKIQNQTNKNNNNQQKTPSNNKEQKLNSEEVQREVQTS
RNNAGNAPSSTASLSSMNDTTSSKVFKKQTDKQQTIDKLQKQNYQYIVQNAQQQINQIQV
QPKQQINPKRIASNQDQPILIESPKSDDLHKEDTLQQISVQKLLQQQQQQQQQQIINQNA
MKLINMLQIPEIGISSQDIQKQIQLTNSQKPLMLDHIQKLEEISMSGDQSKSYQNVVLSD
KEIQNIERKRIQKEQSLEQRQDFSIQYFEDYMSAQGQNIRFGSSQDLSSKQKQNLNNSTS
GSNQGSSKKSQQNPQVNNIIVKTLKNFGQSETVQIQFEQPSENSLKRKIIEQNNSNSSEG
LSKKRIYEKITNIGKEDNPITIDD


>TTHERM_00348490(gene)
ATGATAGATTAGAATATACAAAAATTGGATATGGATAACTTTTACTTAAAAATAATGAAA
GCAGGAATTGTTTAGTTTAAGCTTGAAAAATCAGAGAGAGCTTAAATCTGGTAAGATTTA
GCTAAGAAGGGGAAAATAAGTAAGCAATAGGCGCAAGGAGAAGCTGAACTTGCTAAAGAA
TTAGTAGAGTTCTACTTAAAACATCCTGAAAGAGATGGTTAGGCAAAGTAACTAAGTGAG
TATTTTAATAAAAATGTGCAGGTGAAAGTTGAAGGAATTTTTAAATATTATATCGAAAAC
GCTATAAAGCCATAATAATAGTAAGAGGCAAAAATGAAGAGCGATTATAGTAATGCCGCC
TTCTATCAGCAATAACAACAACAACAACAGTAAACATTTATTTTATTTTCAAATTAATTA
TTTAACTACTAATAAATAAATAAACAATTGATTGAAAAAAATAATAGAGCGTTTTAAGTC
TTTCTTCATCAAAATAAATGAAAGCAATATTCCCAATTTTTAAAGAAAGAAAGTGAGAAA
AAAATATATTTATGCAAGCATTTATTATTTATGCTTTTCAGATTCAAATAAAAATTTGAG
TTTTAAAAAAATGAATCAAAAAATTTTTTTATTCGTAATAATCTAAGCGCACTATTTTAT
TTATTTCAAAGAGATAAGAATCAAATAGAAAATGACTATATATCTATCTATCTTCTATCT
ATCTATTTATCTATTAATTTATTTACTTATTTATTTATATGTTGAGGATATTAAATTAAA
GTGAGTAGTTGAGTGAGTGCATTATACTGTACAAAATCAATTAATAAATTTATTAAGTAC
AAAAATTTTTTTCGAAATTAATTAATTTATCATTTTGAATGAATCTTAGTTAAAAATCTC
AGCTTGATTTTGTTCATAGAATTTTTAATTATTATTTTATTCTCGCTTTTTCCCCACTTG
ATACAATTTTCTATTTACCTTTCAGAGCAAATTTTATCTTGAAACCTTCTAATTATTATC
CCTCATTGAATTTTCTCAAAAATAAATTACTTTATCCAAATATTTTTTCATTCAATTCAT
TCATTCATTCTTTATTTGATTCGTTCTTTGGCTTTCTGAAATTCAATTTCAACATTCAAA
TATAATTTTTTTACAACCCAAGCTCTGTCTACAATTTATTCTAATTGATTAGTAGTTTAC
ATTAATTTATTGATATGTTTAGTTTTTAATGCATTTCTAAAATTTTATATCTTTAAATTA
TAATTAGATATGATGCATAACAACTAAAATACTTGCAGTAAATGAATTACGGTAATACTT
CGAGCTTAATGGGAATGTCTATGGCTTCAATGCCTACAAATTAAACTCCATTCTTACAAT
ATAATCCTAGTGTGATGAATCCTCTTTTTAACAGCTTATCTTTTTAGTAAAGCACTCCAA
CTGAAAGCCTTGGCTTACCATACGGATATTTTCAACTTCCTAATTAATTTATGCATCCTT
AAAGTAATTAAGGAGTGCCTTAGCTACAGCAAACTTATATGTATAACAAGCCTCATGATA
TTTCTGGTATTAATACTGCTGCTTATACGACTACTCCTTAAAGCTACATAAATTCACTAA
ATTTAGGATAATAAGTTGGGTTCGTAAACTCTCTTCCATAGAGCCTTTATGGTTCTCAAT
TTATTAACTAATAATAGGCTGCAGAAGCTGCAGCGACTTAGACTTAAATTGATTCTTCAA
GAAACTTTAATAACTATTTCAATAATATTAATGGTTTTGCTAAGGGAGCTGAAAATACTT
AATATCAAGTTGACTAGCTTATGCAAATTTAAGCTGCTAATCAGCCTTAATAACAAAAGA
TTGTTTAGACTTAAAAATAAATCCAAGCGCCTTATTCCCTTCAAAATTAATAATAATAAT
AATTTTAAATTTCGTAATAATATTAGTAATAAGCATAGTTACCTCAATAACAATAATTAT
AAGCATAAAGCCAACAGAGGTAAACAGCTCAACCTGCAGCTTCAAAATAAAAGTAGTAGA
CATCTAGCAGTAGCACTCTTCCCAACATATCTTAACCTAATCAACCTTTCGGTTTAGCAA
TAAGCGGAAGTAGCAATAAACAAGTTTAGTCAGCTGCGAATAATTCGTCATCAAATAAGA
GCTCAAAGCTTGGAGTATCTGAAATAACACCCTAAAATTAGAAGCAATCATCTAGTTCAT
CTAGCTCAAAGTCAAAATCTAAGTCCAGCAATAATAGCAGCGCAATTAACTTGCTGTAAT
AAACTTAAATACCAATGAACAACACTTATAATGTGTATCCACAAAACAGGAATGGAGCAA
TCCCAAATTAAGTAAAAATAATAGAAACAGAAGCAATCAAAAGCTGTATTTGCGCTTAAG
TACCACGTTTGCGCAATTCCTAATCAGAATTAATTTAGTGTAAGAATAAAGGATGTGAAC
ACAAACTGCATCTAAGCTGTATGAGGATTTCACCTAAAGATGAAGAAAGCATTACCCAAT
TTGAATGCCCTTCCTGCATATTAAAAAAGTATGATCCTCTCCATCATGTCGAACAAACTT
TGATAGATTGCTAAGTAATGATGGGTATTCCCAATAAGTAGCTTGATTTTTAGTTAACTA
CAGAGATGTTTACAAAAATAAAAGATCACAGCGAGTATTCCGTAGAAATTCGTTGCATCC
GAATAGATGGAACCAAAAATATATACGAAACAACTTGGCCAGATTTTGGTAATTTGAGAA
TGAATAATGAAGTCATATTAGAACTCAAACCCCTCCAAAATAATAGCTCACTTAAAAAGC
GTAAAGACGAAAAGCATACTTTTAAAGGAGTTAAGAATCTAAAAGAAGGAATAAATCACC
TTCAAATATCAGAATTCAATTGCAATATAATTGAAAAGTAGTAATTGCGTATAACAGAAA
ACTCCCTTCATTGCATTTCCGTCTTTATTATACGTAGACTCACTGTAGATTAGCTAGTTT
CTAATATAAGAAGAGAATCTACCCGTCCTGCTGATGAGTGTAAGCAATAAATCTAAGACT
ACTTCCATCGCCAAAACAAGAAATCTTCCCACGAAGAAGATGATGATGATCTCTGCATTG
ACAGTCTGAGTGTCCCTCTAACTTGTAGCTTAGATATGAAACTCATATAAACACCTGCAA
AAGGTCGTTTTTGCAAGCATTTCTAATGCTTTTCTCTTGAAAACTTCATCATCACCACAG
AAACAGTGAATCCTCGTAAATGGAAGTGCAATATCTGCAAGGCTAAATGCTACGACATCA
TTATTGATGAATATATTCTTAAAATTATCTAAGAAATAAATGAAAAGTAAATTAAGAATG
TGACTGATGTCAAATTCGATGGTAAAGGTTAGTACTCCTTTGATCAATAGTCATATTCAG
ATGATGACGATGACTACGATGATGATTCCAAGCCAATAGTTAAGAAGCCTTCATAAAATT
AAGCAAGTGCTCCAGCTCCTGCAGCCGCATAGCCTATTACTGTATCTCCCACTAATTCAA
ACTAAGCTGTGCCTATCCAATCTGTATAAGCTTAATTGATCAATAAAGCTCCTATTAATG
GTAACAACAATCCAAAAGGAGTCAATATAGAATCCCATTCCAACAGCAATGCTCTTGAAT
CTTAGTAATTATAAATTTAAGATCAAGTAAGCGGTGGAAATAAAAAGAAGTCATAACCGC
ATTAAATTTTAGTTATTGATAGTGATGAAGAGGAGCCTCCAATATAAAAGAAGGCCTAAA
CTGTTGCTCCCGCTCCTGCGCAACTTCTTCAATAAGTTCCTCTCTAAATACAGGCACTTC
AATAAAATGGTTAACCTCACCACCACCACCATTTAAATATTCCTTAAAATAATTTTCCTG
CAAACGTCCAGAATGGATCTGGCATAAGTATCCATTAAAATACTAATCTCATGAACCTGA
ATCAGGCTGCTAGCTTAAATGGAGTTTATTACAAAAATTTACAGAACGCCAACTCTCACT
AGACATCCAATACAGCTGGGTTAAATACTGTAAATTCATAAAATATTAATTAAACGATTA
CCCTAATTAATAAAGATAAAGATTAATCTTCAAATTAATCTTCTAAAAATATTATTACTA
AAAGCAAGAAAACCGTAATGTGTGAAGAAGAGAACAAAGAGACTTCTAAAATATAAAACT
AAACAAATAAAAATAACAACAATTAATAAAAAACACCTTCAAACAACAAAGAGTAGAAAT
TGAATTCTGAAGAAGTCTAGAGAGAAGTTCAAACAAGTAGAAATAACGCTGGTAACGCAC
CATCAAGCACAGCCAGTCTTTCTTCCATGAATGATACTACATCTTCAAAAGTGTTTAAAA
AGCAAACGGATAAGCAGCAGACAATAGATAAATTATAAAAATAAAACTATTAATATATTG
TTTAAAACGCATAATAATAGATCAATTAAATTTAAGTATAACCCAAATAATAAATTAACC
CTAAAAGAATAGCATCAAATCAAGACTAGCCAATACTAATAGAAAGTCCGAAATCCGATG
ATCTACATAAAGAAGACACTCTTTAATAAATATCTGTTTAGAAGTTGTTATAGTAGTAAT
AGCAGTAACAGCAACAATAAATAATAAATTAAAATGCAATGAAGTTAATTAATATGCTAT
AAATTCCTGAAATTGGAATTAGTAGTTAAGATATTTAAAAATAGATTCAACTCACAAATA
GTTAGAAGCCCTTGATGCTAGATCACATTTAAAAATTGGAAGAAATATCTATGAGTGGAG
ACTAAAGCAAGAGCTATCAAAATGTTGTATTGTCAGATAAAGAAATACAAAACATTGAAA
GGAAGAGAATATAAAAAGAATAGTCTTTAGAATAACGTCAAGATTTTAGCATTTAATATT
TTGAAGATTATATGAGTGCTTAGGGACAAAATATAAGATTTGGTAGTTCTTAAGATCTTT
CATCCAAGCAAAAATAAAACTTAAACAATAGCACTAGCGGAAGTAACCAAGGTAGTTCTA
AAAAGAGTCAACAAAATCCTCAGGTTAATAACATCATCGTTAAAACGTAGATATAAAATT
TAATTAAATACTTTTCAGAATTACCTTTATTTCCTCTTTCTAGCGATGAAGAGATTTAAA
TGCATGATGATAGAGATTATTAGAATGATGATGAAGAAGAAGAAGAAGAATAAGATAGTG
ATGAAAATGATAGTTAGAATTCTAACACTCACCAGGTTAATCAAGAAAGGAATTATAATT
ATTAGAGAAATAGATATAGGATAAGTTAGGATGAAGATTCAAATACTTTTGAGGAAGATA
TAGGATTTCAAAAGTAATTAAGAATATCATCTCTAAATTACAAATAGTCAAAGAATAGTA
AAAGTAAAAAGTTAAAAAAAGATGTAAATTCTAATTAGGTTGCATAAACAGAAAAAATAT
ATGCAAACTTAGAATAAAAGGATTCAATTAAACAACAGCAAAAAGAAATAATCAATAAAA
TTGTAGACTAATAGAAAAAAATAAGAAATGAATAAACTAACAAAAGAATGGATGTAGAAT
TTAGTAACTAAAGTTATTAATCTACAAGTGAAAGCAGTTAAAACAAATTTTAGTAGAAAG
ATACTCAAAATAAAATGAGTAATGAATTAGAACAAACAAAGTATTATTCATTAAAAAGTA
ACAATAAGAGAAATATTATCTTAAAAAAACCATAATAAGTTCATCTTTCTTCTTCTTCAT
CATCATCACCTATTTCTTAATAGTCTTTATCACATGCTTTACAAGATACTCTTTAAGCTA
GAGAGAATTAGAAATAAAGATAGTAAAATAAAAAATGATTTTTAGGAATTAGCATTATCG
TTATAAAAATTCATAAAATTTATTATTAAATAGATTAAAAAATTTTGGGTAGTCAGAAAC
AGTGCAAATTCAATTTGAGTAACCTTCTGAAAATAGCTTAAAAAGAAAAATGTAAATTAA
ATTTACAATTAATTTACTTATTAATTATTTAAATTTTTTTTGATTTTTTAACTTATATTT
ATTTTTGAAATATTAATAAATAGCATAGAATAAAATAATTCTAATAGCAGTGAAGGTCTC
AGTAAAAAGAGAATATATGAAAAAATTACCAACATAGGAAAAGAAGATAATCCTATAACT
ATTGATGATTGA