Identifiers and Description

Gene Model Identifier

TTHERM_00346900

Standard Name

None

Aliases

PreTt26265 | 35.m00326 | 3695.m00157

Description

Serine carboxypeptidase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 91.6%

TetraMine Data

TTHERM_00346900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19027.19.997093137033517e-262serine carboxypeptidase (415 a
a)
OxytrichaContig22465.0.g724.998332321421836e-154Serine carboxypeptidase
SGDYMR297W3.001096210761825e-82PRC1 Vacuolar carboxypeptidase
Y (proteinase C; CPY), broad-
specificity C-terminal exopept
idase involved in non-specific
protein degradation in the va
cuole; member of the serine ca
rboxypeptidase family
DictyBaseDDB_G02919126.999281070199524e-80DDB_G0291912 on chromosome: 6
position 931229 to 932834
WormBaseWBGene000087412.9997246065828143e-59Uncharacterized serine carboxy
peptidase F13S12.6 status:Co
nfirmed UniProt:P52715 pro
tein_id:CAA88947.1
Stentor CoeruleusSteCoe_72763.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00346900(coding)
ATGAGAAAGATTGTCCTTCTTTTAGCTCTTTTGAGTTTGGCTTTCGCTGACTAAAACCCC
ATTTTCTTGAACGAAACTTACAACACTGGTTTTGTTAAGATCAGAAAGGATAGCGACATT
TTCTATTGGTAATTTGACTCTCGTTCAAACCCTTCCACTGATCCCTTGGTCATTTGGTTG
AATGGTGGCCCTGGTTGCTCTTCCCTCACTGGTCTTTTTGCTGAAAATGGTCCTTTCAAG
GTCAATGACGATCTTACTCTCTCCTCCAACGCCTACTCTTGGAACTCCAATGCTAACCTC
GTCTTCGTTGACCAACCCGTAGGTACTGGATACAGCAGAGCTGGTTTCAATGAATTCACT
CACAACGAAACTTAAATTGCTGAAGATTTCTACTAATTCTTACTCGGTCTTTATGGTCGT
TTCCCTCAATTCAAGGGTAAGAAACTCTTCATTACTGGTGAATCATACGCAGGTCACTAC
ATCCCTGCCATCAGTGCTAAGATTGTCTCTGAAAACAACTAATGGATCAAGCTCGCTGGT
TCTGCCATCGGTAACGGTTTGGTATCTCCTTACTAATAATACCCCGAATATGCTAACTTT
GCTTATGAAAATAACTTGATCGGTAAGGTTAAATACAACATCTTAAAGGGAGCTTTCTGG
GCTTGCCAACAATTAATTAAGGCAGGTGTCTCTTGGTTAGCTACCATGGAAGAATGCCAA
TTAGGTGTTACCAGCATTTTGGGTAATCCCTTAAAACCTAAATTCAATGTTTACGATATC
AGAGACAAGTGTTCTACTCCTCCTCTCTGTTACGATTTCTCTAACATTGACAAGTTCCTT
GCTTTACCTCAAGTTATCTAAGCTCTTGGTACTCAAGGCAGAAAGTGGGTTGAATGCTCT
AAGCCTGTTCACTTAGCTTTAACTGCTGACTGGATGTTAGATCTTTCTCCTCAAGTTTCT
TACCTCTTATCTAAGGGTGTTAAGGTCCTCGTTTACTCTGGTGACTAAGATTTCATTTGC
AACTGGAGAGGTGGTGAAAAGTGGACCTACGAACTCTAATGGAGCAAACAAAAAGAATTC
TAATAAACCGAATACACTTAATGGTAAAACTTCGGTGCTTACAAGACTGTTGATAACTTC
ACCTTCTTAAGAGTCTACTAAGCTGGTCACATGGTTCCTATGGATCAACCTCAAGCTGCT
CTTGAAATGCTTAACCTCTTCATCAGTGGTCAACCCTTGTGA


>TTHERM_00346900(protein)
MRKIVLLLALLSLAFADQNPIFLNETYNTGFVKIRKDSDIFYWQFDSRSNPSTDPLVIWL
NGGPGCSSLTGLFAENGPFKVNDDLTLSSNAYSWNSNANLVFVDQPVGTGYSRAGFNEFT
HNETQIAEDFYQFLLGLYGRFPQFKGKKLFITGESYAGHYIPAISAKIVSENNQWIKLAG
SAIGNGLVSPYQQYPEYANFAYENNLIGKVKYNILKGAFWACQQLIKAGVSWLATMEECQ
LGVTSILGNPLKPKFNVYDIRDKCSTPPLCYDFSNIDKFLALPQVIQALGTQGRKWVECS
KPVHLALTADWMLDLSPQVSYLLSKGVKVLVYSGDQDFICNWRGGEKWTYELQWSKQKEF
QQTEYTQWQNFGAYKTVDNFTFLRVYQAGHMVPMDQPQAALEMLNLFISGQPL


>TTHERM_00346900(gene)
ATGAGAAAGATTGTCCTTCTTTTAGCTCTTTTGAGTTTGGCTTTCGCTGACTAAAACCCC
ATTTTCTTGAACGAAACTTACAACACTGGTTTTGTTAAGATCAGAAAGGATAGCGACATT
TTCTATTGGTAATTTGACTCTCGTTCAAACCCTTCCACTGATCCCTTGGTCATTTGGTTG
AATGGTGGCCCTGGTTGCTCTTCCCTCACTGGTCTTTTTGCTGAAAATGGTCCTTTCAAG
GTCAATGACGATCTTACTCTCTCCTCCAACGCCTACTCTTGGAACTCCAATGCTAACCTC
GTCTTCGTTGACCAACCCGTAGGTAAGAACAAAAACATCATTTAATTGTTTTTTACTGTT
ATTACTTCTCACTCTCTATTTACTTGATTTCTATTCATAATTTATAAGCATTCAAAATCA
AATCCAAACGATAAATTAAAATTATATAAGTATAATTAAAATAAGGAAAGCAACCTAAGA
TTTACTATTTTTTAAATTTTAAGATTCCTTTCTATTTTGACAGTTTAATCGATAATTTCT
ATTTTAATAAGGTACTGGATACAGCAGAGCTGGTTTCAATGAATTCACTCACAACGAAAC
TTAAATTGCTGAAGATTTCTACTAATTCTTACTCGGTCTTTATGGTCGTTTCCCTCAATT
CAAGGGTAAGAAACTCTTCATTACTGGTGAATCATACGCAGGTCACTACATCCCTGCCAT
CAGTGCTAAGATTGTCTCTGAAAACAACTAATGGATCAAGCTCGCTGGTTCTGCCATCGG
TAACGGTTTGGTAAATATTCAAGATATTTATTAAGTTTTTCTTGCTTATTTTGTGAATTA
AATGTTCATTCAAATAAATAAGTTTCTGTTAAATATTGTAACAAACTTTAATGACAAATA
AATGGATGATTATTAATTTAATCTTGTTAAATATAATTTTTAAAATTTCACTTTAATTAT
TAAAATAGGTATCTCCTTACTAATAATACCCCGAATATGCTAACTTTGCTTATGAAAATA
ACTTGATCGGTAAGGTTAAATACAACATCTTAAAGGGAGCTTTCTGGGCTTGCCAACAAT
TAATTAAGGCAGGTGTCTCTTGGTTAGCTACCATGGAAGAATGCCAATTAGGTGTTACCA
GCATTTTGGGTAATCCCTTAAAACCTAAATTCAATGTTTACGATATCAGAGACAAGTGTT
CTACTCCTCCTCTCTGTTACGATTTCTCTAACATTGACAAGTTCCTTGCTTTACCTCAAG
TTATCTAAGCTCTTGGTACTCAAGGCAGAAAGTGGGTTGAATGCTCTAAGCCTGTTCACT
TAGCTTTAACTGCTGACTGGATGTTAGATCTTTCTCCTCAAGTTTCTTACCTCTTATCTA
AGGGTGTTAAGGTCCTCGTTTACTCTGGTGACTAAGATTTCATTTGCAACTGGAGGTAAT
CTATATATCACAAATTATTTAACCAACTTTAAATATTACTTATTTATTTATTTACTTACT
TACATTATTTTCCTAATTTTAACAGAGGTGGTGAAAAGTGGACCTACGAACTCTAATGGA
GCAAACAAAAAGAATTCTAATAAACCGAATACACTTAATGGTAAAACTTCGGTGCTTACA
AGACTGTTGATAACTTCACCTTCTTAAGAGTCTACTAAGCTGGTCACATGGTTCCTATGG
ATCAACCTCAAGCTGCTCTTGAAATGCTTAACCTCTTCATCAGTGGTCAACCCTTGTGA