Identifiers and Description

Gene Model Identifier

TTHERM_00346550

Standard Name

None

Aliases

PreTt26236 | 35.m00297 | 3695.m00128

Description

polyubiquitin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.6%

TetraMine Data

TTHERM_00346550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14651.13.998941839720987e-159ubiquitin family protein (231
aa)
OxytrichaContig148.1.g134.0006013729588566e-158Ubiquitin family
DictyBaseDDB_G02869075.999579683817102e-155ubqD on chromosome: 4 position
5083931 to 5084620
WormBaseWBGene000067273.9992399120784785e-154locus:ubq-1 status:Confirmed
UniProt:G8JY83 protein_id
:CCD68780.1
SGDYLL039C2.999720831252636e-153UBI4 Ubiquitin, becomes conjug
ated to proteins, marking them
for selective degradation via
the ubiquitin-26S proteasome
system; essential for the cell
ular stress response; encoded
as a polyubiquitin precursor c
omprised of 5 head-to-tail rep
eats
Stentor CoeruleusSteCoe_202468.854771883513433e-70

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00346550(coding)
ATGTAAATTTTTGTTAAGACTTTAACTGGAAAAACAATCACTCTAGATATTGAGGCCTCA
GACACTATTGAAAACGTTAAGGCTAAAATTCAAGACAAGGAAGGAATTCCACCTGATTAA
TAAAGACTTATCTTTGCTGGCAAGTAATTAGAAGATGGTAGAACTCTTTCTGACTATAAT
ATCTAAAAAGAATCAACTCTACATTTAGTTTTGAGATTAAGAGGTGGTATGCAAATTTTT
GTTAAGACTTTGACAGGTAAGACTGTTACTTTAGATGTTGAAGCTACTGATACTATTGAA
AATATTAAGGCTAAGATTCAAGATAAGGAGGGTATTCCACCTGATTAATAAAGACTTATC
TTTGCTGGCAAGTAATTAGAAGATGGTAGAACTCTTTCTGACTACAATATCTAAAAAGAA
TCTACTCTCCACTTAGTTTTGAGATTGAGAGGTGGTATGTAAATTTTTGTTAAGACTTTA
ACAGGTAAGACTATCACTTTAGATGTTGAATCTTCTGATACTATTGAGAATATTAAGGCT
AAGATTCAAGACAAGGAAGGAATCCCACCTGATTAATAAAGACTTATCTTTGCTGGTAAA
TAACTTGAAGATGGAAGAACTTTATCTGACTATAACATCTAAAAGGAATCAACTCTTCAC
TTAGTTTTAAGATTAAGAGGTGGTTGA


>TTHERM_00346550(protein)
MQIFVKTLTGKTITLDIEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLDVEATDTIENIKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVESSDTIENIKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG


>TTHERM_00346550(gene)
ATGTAAATTTTTGTTAAGACTTTAACTGGAAAAACAATCACTCTAGATATTGAGGCCTCA
GACACTATTGAAAACGTTAAGGCTAAAATTCAAGACAAGGAAGGAATTCCACCTGATTAA
TAAAGACTTATCTTTGCTGGCAAGTAATTAGAAGATGGTAGAACTCTTTCTGACTATAAT
ATCTAAAAAGAATCAACTCTACATTTAGTTTTGAGATTAAGAGGTGGTATGCAAATTTTT
GTTAAGACTTTGACAGGTAAGACTGTTACTTTAGATGTTGAAGCTACTGATACTATTGAA
AATATTAAGGCTAAGATTCAAGATAAGGAGGGTATTCCACCTGATTAATAAAGACTTATC
TTTGCTGGCAAGTAATTAGAAGATGGTAGAACTCTTTCTGACTACAATATCTAAAAAGAA
TCTACTCTCCACTTAGTTTTGAGATTGAGAGGTGGTATGTAAATTTTTGTTAAGACTTTA
ACAGGTAAGACTATCACTTTAGATGTTGAATCTTCTGATACTATTGAGAATATTAAGGCT
AAGATTCAAGACAAGGAAGGAATCCCACCTGATTAATAAAGACTTATCTTTGCTGGTAAA
TAACTTGAAGATGGAAGAACTTTATCTGACTATAACATCTAAAAGGAATCAACTCTTCAC
TTAGTTTTAAGATTAAGAGGTGGTTGA