Identifiers and Description

Gene Model Identifier

TTHERM_00343680

Standard Name

PRP11 (Pre-mRNA Processing factor 11)

Aliases

PreTt26147 | 35.m00208 | 3695.m00041

Description

PRP11 splicing factor 3A subunit 2; Spliceosome associated protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00343680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14698.12.0001055857497602e-161spliceosome associated protein
(230 aa)
OxytrichaContig15681.0.g151.9998521972819316e-89Zinc-finger of C2H2 type
WormBaseWBGene000086832.0006821221283624e-88locus:repo-1 status:Confirme
d UniProt:Q19335 protein_i
d:CAA92593.2
DictyBaseDDB_G02938769.996373193201036e-79sf3a2 on chromosome: 6 positio
n 3412404 to 3413152
Stentor CoeruleusSteCoe_83021.3336148155022614e-34
SGDYDL043C0.000000000000001999258566166494PRP11 Subunit of the SF3a spli
cing factor complex, required
for spliceosome assembly

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00343680(coding)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA


>TTHERM_00343680(protein)
MVDRQHRPGAKTGSGGPASSQDANIEHRERLKKLALETIDIKKDPYFMTNHLGTYECRLC
LTLHTNEGSYLAHTQGKKHQTNLQRRQSKERQEQNIQLQQNQTKGLQKKKTIKIGRPGYK
IFKMIDPTSGQKQITFEIDYEQIDASWKPFYRIMSSYEQKVEQFDKNYQYVVFAAEPYDN
IAFKIPNMEIDMEEGKFYQDWNKDKKKYTLHLTFKDRQNKQSRNQKN


>TTHERM_00343680(gene)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA