Identifiers and Description

Gene Model Identifier

TTHERM_00343500

Standard Name

None

Aliases

PreTt26130 | 35.m00191 | 3695.m00025

Description

signal recognition particle 54 kDa protein 1, SRP54

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614

Domains

  • ( TIGR00347 ) dethiobiotin synthase
  • ( PF01926 ) GTPase of unknown function
  • ( PF02978 ) Signal peptide binding domain
  • ( PF00448 ) SRP54-type protein, GTPase domain
  • ( TIGR01725 ) phage protein, HK97 gp10 family
  • ( TIGR00959 ) signal recognition particle protein
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF02881 ) SRP54-type protein, helical bundle domain
  • ( TIGR01425 ) signal recognition particle protein SRP54
  • ( PF01656 ) CobQ/CobB/MinD/ParA nucleotide binding domain
  • ( TIGR00064 ) signal recognition particle-docking protein FtsY
  • ( PF03205 ) Molybdopterin guanine dinucleotide synthesis protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00343500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_308850
WormBaseWBGene000090129.997093137033517e-262status:Confirmed UniProt:G5E
E80 protein_id:CAA91040.1
Tetrahymena borealisEI9_14710.19.997093137033517e-262signal recognition particle pr
otein 1, SRP54 (525 aa)
OxytrichaContig14031.0.2.g409.997093137033517e-262SRP54-type protein, GTPase dom
ain
DictyBaseDDB_G02754553.999538006653402e-149srp54 on chromosome: 2 positio
n 6110111 to 6111847
SGDYPR088C6.9983072483574615e-143SRP54 Signal recognition parti
cle (SRP) subunit (homolog of
mammalian SRP54); contains the
signal sequence-binding activ
ity of SRP, interacts with the
SRP RNA, and mediates binding
of SRP to signal receptor; co
ntains GTPase domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00343500(coding)
ATGGTGCTTGCAGATCTTGGTAAAAGAATCAATAATGCCTTACAGCAATTAAATAAGGCT
CCTGTCATTGATGAAGAATTATTAAATTAAGTTTTGAAAGAAATTTAGTTGGCTCTTCTC
TAATCTGATGTTAATGTCAAATATGTAGCCAAACTAAAGAGTAATATCATCATGAAATTT
AAGATGGAAGATAGTTAGGGTGTTAATTTAAAGAAGATGATTCAGTAGGCAGTCGTTTAG
GAGTTGACATAAATGTTAGATTCAAATAAAAAGCCATTCGTTCCTAAAAGAGGCAAACCA
AATGTTGTTATGTTTGTTGGTCTATAGGGTGCTGGTAAAACCACCACTTGTACAAAGTAC
GCATATCACTGGTAAAAAAAAGGTTGGAGAACTGCATTGATTTGTGCTGATACTTTCAGA
GCAGGTGCTTTCGATCAACTTAAGTAAAATGCAACAAAAGTTAGAGTACCTTTTTATGGT
AGCTATTCCGAAACTGATCCTGTAGCTATTGCCGAAGAAGGTGTTAAACACTTTAAAAAG
GAGAACTACGAAATGATTATTGTTGATACTTCAGGTCGTCACAAATAAGAAAGTGAATTG
TTCGATGAAATGAAACAAGTTCAAGCAGCAGTTAACCCAGATGAATGTATTTTCGTCATG
GACGGTTCGATTGGTTAAGCTTGTTACGATTAAGCTTAGGCTTTCAGAAATGCTGTCAAT
GTTGGTAGTGTTATTATTACTAAGCTTGATGGTCATGCTAAGGGTGGTGGTGCTTTGAGT
GCTGTCGCTGCTACTGAGAGTCCTATTATTTTTATTGGTACTGGTGAACATTTTGAAGAC
TTGGAACCTTTCAATCCTGAAAGTTTTGTCAAAAGACTACTTGGTTTGGGTGATATTAAG
GGTATGATAACAACTGTCACTGAAGCTGTTGATATGGAAACTTAAGGAAAAGCCATCGCA
AATATAACAAAAGGACAGTTCTCTATTAGAGATTTCTAGGCACAATATAAGAGTATCTTA
AAATTAGGTTCAATTAACTAGTTTATGAGTATGATTCCTGGTATGGGTAACAGTATACTT
GATAAAAATAATGAAAAGGAATCTATTAGAAAAGTAAAGAAATTCTTAACTATCATGGAT
AGCATGAACGATAACGAATTAGATGGTGTTGTTGCCATTAATCCTTCTAGAATTGTCCGT
ATTGCAAGAGGTTCAGGTTCTTCATTAGAAGATGTTAACTAACTTTTAGACGAGTACAAA
AAAATATCTAAAGTATTTATTGGATTAGGTAAAGGTCTTGGTAAAGGAGGTGATATTGGT
AATATAATGAGAAACCCTAACTAAATAAAGAACTAAATGGGTGCAGCCCTCGACCCTAAG
ATGATCTAAGGCATGGGTGGTATGGGTAATATAATGAACATGGTCAAAGAAATGTCAAAG
ATGGAAGGAGTAGGTGATCTTATGAAAGGATTAGGTGGAGGAAATATGGCTGAAATGATG
AAAAGTTTGGGTGGTAACATCCCTGGTTTATCAGGTTTAACTAAAAAAAGAAGATGA


>TTHERM_00343500(protein)
MVLADLGKRINNALQQLNKAPVIDEELLNQVLKEIQLALLQSDVNVKYVAKLKSNIIMKF
KMEDSQGVNLKKMIQQAVVQELTQMLDSNKKPFVPKRGKPNVVMFVGLQGAGKTTTCTKY
AYHWQKKGWRTALICADTFRAGAFDQLKQNATKVRVPFYGSYSETDPVAIAEEGVKHFKK
ENYEMIIVDTSGRHKQESELFDEMKQVQAAVNPDECIFVMDGSIGQACYDQAQAFRNAVN
VGSVIITKLDGHAKGGGALSAVAATESPIIFIGTGEHFEDLEPFNPESFVKRLLGLGDIK
GMITTVTEAVDMETQGKAIANITKGQFSIRDFQAQYKSILKLGSINQFMSMIPGMGNSIL
DKNNEKESIRKVKKFLTIMDSMNDNELDGVVAINPSRIVRIARGSGSSLEDVNQLLDEYK
KISKVFIGLGKGLGKGGDIGNIMRNPNQIKNQMGAALDPKMIQGMGGMGNIMNMVKEMSK
MEGVGDLMKGLGGGNMAEMMKSLGGNIPGLSGLTKKRR


>TTHERM_00343500(gene)
ATGGTGCTTGCAGATCTTGGTAAAAGAATCAATAATGCCTTACAGCAATTAAATAAGGCT
CCTGTCATTGATGAAGAATTATTAAATTAAGTTTTGAAAGAAATTTAGTTGGCTCTTCTC
TAATCTGATGTTAATGTCAAATATGTAGCCAAACTAAAGAGTAATATCATCATGAAATTT
AAGATGGAAGATAGTTAGGGTGTTAATTTAAAGAAGATGATTCAGTAGGCAGTCGTTTAG
GAGTTGACATAAATGTTAGATTCAAATAAAAAGCCATTCGTTCCTAAAAGAGGCAAACCA
AATGTTGTTATGTTTGTTGGTCTATAGGGTGCTGGTAAAACCACCACTTGTACAAAGTAC
GCATATCACTGGTAAAAAAAAGGTAAATTAATTTCCAAAATATAAGCAATTCAATGTGAA
AATGTGAGAATTTTTTTTAATTTGTACATCTAATTCTCCTGTGCTTTAGAATTTGCACTA
TTTAGCTTCAATTAAAGTAGTTATAGCCTCAAATTTTTAATTGTTCTAAAAAGAAAAGGA
GTTAATTTTAAATTTTAATGAATTTGTTAATTCATAGAAGGAAATTGTTTATACTAAACA
TTTAAATTTAGTAAAATACAAATTATAATGATAAAAGTTTTAGATTTATAAACTCATTCT
TAGATTTCATTTCATTTCGCTACTAGTTTTTTTGAATTTTTAGAACTAAAACAAATATAT
CATTCTTTATTAATTAACAGGTTGGAGAACTGCATTGATTTGTGCTGATACTTTCAGAGC
AGGTGCTTTCGATCAACTTAAGTAAAATGCAACAAAAGTTAGAGTACCTTTTTATGGTAG
CTATTCCGAAACTGATCCTGTAGCTATTGCCGAAGAAGGTGTTAAACACTTTAAAAAGGA
GAACTACGAAATGATTATTGTTGATACTTCAGGTCGTCACAAATAAGAAAGTGAATTGTT
CGATGAAATGAAACAAGTTCAAGCAGCAGTTAACCCAGATGAATGTATTTTCGTCATGGA
CGGTTCGATTGGTTAAGCTTGTTACGATTAAGCTTAGGCTTTCAGAAATGCTGTCAATGT
TGGTAGTGTTATTATTACTAAGCTTGATGGTCATGCTAAGGGTGGTGGTGCTTTGAGTGC
TGTCGCTGCTACTGAGAGTCCTATTATTTTTATTGGTACTGGTGAACATTTTGAAGACTT
GGAACCTTTCAATCCTGAAAGTTTTGTCAAAAGACTACTTGGTTTGGGTGATATTAAGGG
TATGATAACAACTGTCACTGAAGCTGTTGATATGGAAACTTAAGGAAAAGCCATCGCAAA
TATAACAAAAGGACAGTTCTCTATTAGAGATTTCTAGGCACAATATAAGAGTATCTTAAA
ATTAGGTTCAATTAACTAGTTTATGAGTATGATTCCTGGTATGGGTAACAGTATACTTGA
TAAAAATAATGAAAAGGAATCTATTAGAAAAGTAAAGAAATTCTTAACTATCATGGATAG
CATGAACGATAACGAATTAGATGGTGTTGTTGCCATTAATCCTTCTAGAATTGTCCGTAT
TGCAAGAGGTTCAGGTTCTTCATTAGAAGATGTTAACTAACTTTTAGACGAGTACAAAAA
AATATCTAAAGTATTTATTGGATTAGGTAAAGGTCTTGGTAAAGGAGGTGATATTGGTAA
TATAATGAGAAACCCTAACTAAATAAAGAACTAAATGGGTGCAGCCCTCGACCCTAAGAT
GATCTAAGGCATGGGTGGTATGGGTAATATAATGAACATGGTCAAAGAAATGTCAAAGAT
GGAAGGAGTAGGTGATCTTATGAAAGGATTAGGTGGAGGAAATATGGCTGAAATGATGAA
AAGTTTGGGTGGTAACATCCCTGGTTTATCAGGTTTAACTAAAAAAAGAAGATGA