Identifiers and Description

Gene Model Identifier

TTHERM_00339790

Standard Name

None

Aliases

PreTt06120 | 34.m00357 | 3689.m00151

Description

metallo beta lactamase domain protein; RNA-metabolising metallo-beta-lactamase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00661 ) conserved hypothetical protein
  • ( PF00753 ) metallo-beta-lactamase domain protein
  • ( PF07521 ) RNA-metabolising metallo-beta-lactamase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00339790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15084.19.997093137033517e-262metallo beta lactamase domain-
containing protein (645 aa)
OxytrichaContig17827.0.g1087.99823656470583e-173Beta-Casp domain
DictyBaseDDB_G02781899.002171346752006e-170ints11 on chromosome: 3 positi
on 423737 to 426046
WormBaseWBGene000086427.000315720897034e-164status:Partially_confirmed U
niProt:Q9U3K2 protein_id:CAB
54223.2
SGDYLR277C5.997351754165136e-86YSH1 Putative endoribonuclease
, subunit of the mRNA cleavage
and polyadenylation specifici
ty complex; required for 3 pro
cessing, splicing, and transcr
iptional termination of mRNAs
and snoRNAs
Stentor CoeruleusSteCoe_137762.001470128041443e-75

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00339790(coding)
ATGGATTTGAAAAACGTTAAAGATTGTATAGAGGTTTATCCTTTGGGTGCGGGACAAGAT
GTAGGGCGCAGTTGTATTTTGATTAAAATTTATGATAAAATTATAATGTTAGACTGTGGT
TTGCATATGGGTGTAAATGATTTAACAAGATATCCAGATTTCGAAAAGATAAAATAAATT
TGGAATATTCCTGAAAAAAGAAAGTGGGACTAGATCATAGATTTAGTTTTAATATCTCAT
TTTCACTTAGATCATATTGGTGCGCTTCCCTATTTTACAGAAATTTATAATTATGATGGT
CCTATTTATATGACAAGTCCTACTAAGGCACTTCTTCCATACATGTGCGAAGATTTTAGA
AAAGTAATTACAGAAAGCTAAAAGAAAGAGTTTACAGATGATAGTATTCCTTAAACTCCT
GCTTAAAAAATCATAAATGACAGCAGATATCCTTTAATTTATACTTAAGAAAACATCTAA
AAGTGTTTTTAAAAAGCAAAAACTATCTAGTTGCTTGAGACTATTGATGTGAATGGTATA
AAAATTAAGCCTTACTATGCTGGACATGTTTTAGGAGCTTGTATGTTTATGATCGAGTAT
CGAAATGTGAAGGTGGTTTATACTGGCGACTTTCACTCGAATGCTGATAGACATTTAGGA
GCTGCTTGGATCGAAAAAGTAAAACCTGATTTGCTTATTTCAGAGTGTACATACGGCACT
ATTATAAGAGATTCAAAGAGAGCTAGAGAGAAAAATTTCTTAAAACAAATTCAAGAAACA
ATAGATCAAGGAGGAAAAGTTCTCATACCAGTTTTTGCTTTAGGAAGAGCTTAAGAATTG
TGTATTTTGTTAGAAACCTATTGGTAAAGAACACAAAGCTAAGTTCCTGTATATTTTGCA
GCTGGTATGATTGAAAAGGCTAACTTCTACTATAAATTATTTGTGAATTGGACAAACGAA
AAAATAAAAAGTTCATACCTTACAGATAACATGTTTGATTTCAAATATATAAAGCCCTTT
TCAAGATCACTTATAAAGACAAATGGTCCAATGGTTCTTTTTGCAACACCTGGAATGCTT
CATGCGGGTCTTTCGATGTAAGTCTTCAAAGAATGGTGCTATGATGAAAAAAACACATTA
ATTATTCCTGGATATTGTGTAGCTGGAACTTTAGGTAACAAATTGCTTAGTGGTTGCAAG
CAGGTCATTTTAGATAAAAAGGTCTATGATGTTAATATGTAGGTAAAAAATATGAGTTTT
TCTGCACATGCAGATGCTAAAGGAATTTTAGGCTTAATAAAACATTGTGAACCTAAAAAC
GTAATGCTAGTACATGGAGATGTTACTAGAATGATGCCACTGGCAGAAACAATTAGAGAT
TAATTTGAAATATAAGTTTTTACTCCAGCAAATTTTGAATTAAATAAGATCCCTTTAATG
AATGAAGATAACCACTCAATAAAAATTACTGAAGATATGAAAAGAGAGATAGAAGAATAA
AAAATGAATGAAATTAATGGATTGATTTTTTACAATTAGGACAAACAATATTAAATTTTA
AGGGATCTTGAAGAGTTTTAGCAGCTATTAAACTAGTTATCAGATGAATACGATGCATAC
TGGCATAGATTTGAGACAGGATATATAATTAAGATAAATCTGTCAGTAAAAAACAAATGC
TCTGATTCTTAAAAACCTGATTTGATTGATAAAAATAAATTGATTAATCATTACAAGCAA
ATCTTAGAAGCTATTTTGAAAATGCATGAAAAAGCTAAAGATACATTAAGCGATTACTTA
GAATTATGCAACACAGATAATTTTGATGTGCTTGATAATGAATTCTTGGTCATAAAAACA
AGCTAGCAATTTACTCCTTAGCAATAAAAAATAATTGATAGTATCTTCAATGCTTTAAAT
ATATATAACAATAAATGA


>TTHERM_00339790(protein)
MDLKNVKDCIEVYPLGAGQDVGRSCILIKIYDKIIMLDCGLHMGVNDLTRYPDFEKIKQI
WNIPEKRKWDQIIDLVLISHFHLDHIGALPYFTEIYNYDGPIYMTSPTKALLPYMCEDFR
KVITESQKKEFTDDSIPQTPAQKIINDSRYPLIYTQENIQKCFQKAKTIQLLETIDVNGI
KIKPYYAGHVLGACMFMIEYRNVKVVYTGDFHSNADRHLGAAWIEKVKPDLLISECTYGT
IIRDSKRAREKNFLKQIQETIDQGGKVLIPVFALGRAQELCILLETYWQRTQSQVPVYFA
AGMIEKANFYYKLFVNWTNEKIKSSYLTDNMFDFKYIKPFSRSLIKTNGPMVLFATPGML
HAGLSMQVFKEWCYDEKNTLIIPGYCVAGTLGNKLLSGCKQVILDKKVYDVNMQVKNMSF
SAHADAKGILGLIKHCEPKNVMLVHGDVTRMMPLAETIRDQFEIQVFTPANFELNKIPLM
NEDNHSIKITEDMKREIEEQKMNEINGLIFYNQDKQYQILRDLEEFQQLLNQLSDEYDAY
WHRFETGYIIKINLSVKNKCSDSQKPDLIDKNKLINHYKQILEAILKMHEKAKDTLSDYL
ELCNTDNFDVLDNEFLVIKTSQQFTPQQQKIIDSIFNALNIYNNK


>TTHERM_00339790(gene)
ATGGATTTGAAAAACGTTAAAGATTGTATAGAGGTTTATCCTTTGGGTGCGGGACAAGAT
GTAGGGCGCAGTTGTATTTTGATTAAAATTTATGATAAAATTATAATGTTAGACTGTGGT
TTGCATATGGGTGTAAATGATTTAACAAGATATCCAGATTTCGAAAAGATAAAATAAATT
TGGAATATTCCTGAAAAAAGAAAGTGGGACTAGATCATAGATTTAGTTTTAATATCTCAT
TTTCACTTAGATCATATTGGTGCGCTTCCCTATTTTACAGAAATTTATAATTATGATGGT
CCTATTTATATGACAAGTCCTACTAAGGCACTTCTTCCATACATGTGCGAAGATTTTAGA
AAAGTAATTACAGAAAGCTAAAAGAAAGAGTTTACAGATGATAGTATTCCTTAAACTCCT
GCTTAAAAAATCATAAATGACAGCAGATATCCTTTAATTTATACTTAAGAAAACATCTAA
AAGTGTTTTTAAAAAGCAAAAACTATCTAGTTGCTTGAGACTATTGATGTGAATGGTATA
AAAATTAAGCCTTACTATGCTGGTAAGTATTAGCATAAATAATACATTTACTAATTCAAT
TAATTTATAAATTACAATCAATTTTAAAAATTAATATATTTTCATGATTCTTGCTAAAAA
ATTATTTTATTTAAAAATTTTTAAAGGACATGTTTTAGGAGCTTGTATGTTTATGATCGA
GTATCGAAATGTGAAGGTGGTTTATACTGGCGACTTTCACTCGAATGCTGATAGACATTT
AGGAGCTGCTTGGATCGAAAAAGTAAAACCTGATTTGCTTATTTCAGAGTGTACATACGG
CACTATTATAAGAGATTCAAAGAGAGCTAGAGAGAAAAATTTCTTAAAACAAATTCAAGA
AACAATAGATCAAGGAGGAAAAGTTCTCATACCAGTTTTTGCTTTAGGAAGAGCTTAAGA
ATTGTGTATTTTGTTAGAAACCTATTGGTAAAGAACACAAAGCTAAGTTCCTGTATATTT
TGCAGCTGGTATGATTGAAAAGGCTAACTTCTACTATAAATTATTTGTGAATTGGACAAA
CGAAAAAATAAAAAGTTCATACCTTACAGATAACATGTTTGATTTCAAATATATAAAGCC
CTTTTCAAGATCACTTATAAAGACAAATGGTCCAATGGTTCTTTTTGCAACACCTGGAAT
GCTTCATGCGGGTCTTTCGATGTAAGTCTTCAAAGAATGGTGCTATGATGAAAAAAACAC
ATTAATTATTCCTGGATATTGTGTAGCTGGAACTTTAGGTTGCGTTTTAATTTCATCTTT
TTTTTTCCAGTTTTCTAAATTTTCGCAATCTAAAATAATAAAAATTTTAAGTTTTATTCA
GCATAAAATTATTTTTCAAGTAGTATTATGAAAATTAATTTTGAGTTTTATTTATTTTTT
ACTCTATTTGATAAAATAATAGGTAACAAATTGCTTAGTGGTTGCAAGCAGGTCATTTTA
GATAAAAAGGTCTATGATGTTAATATGTAGGTAAAAAATATGAGTTTTTCTGCACATGCA
GATGCTAAAGGAATTTTAGGCTTAATAAAGTAACTAATTTATTTTTTAAATATTTTTTTA
AAAAATCTTCAAAACAAACAATGAAATAATATATTTTAATATACAAAAGACATTGTGAAC
CTAAAAACGTAATGCTAGTACATGGAGATGTTACTAGAATGATGCCACTGGCAGAAACAA
TTAGAGATTAATTTGAAATATAAGTTTTTACTCCAGCAAATTTTGAATTAAATAAGATCC
CTTTAATGAATGAAGATAACCACTCAATAAAAATTACTGAAGATATGAAAAGAGAGATAG
AAGAATAAAAAATGAATGAAATTAATGGATTGATTTTTTACAATTAGGACAAACAATATT
AAATTTTAAGGGATCTTGAAGAGTTTTAGCAGCTATTAAACTAGTTATCAGATGAATACG
ATGCATACTGGCATAGATTTGAGACAGGATATATAATTAAGATAAATCTGTCAGTAAAAA
ACAAATGCTCTGATTCTTAAAAACCTGATTTGATTGATAAAAATAAATTGATTAATCATT
ACAAGCAAATCTTAGAAGCTATTTTGAAAATGCATGAAAAAGCTAAAGATACATTAAGCG
ATTACTTAGAATTATGCAACACAGATAATTTTGATGTGCTTGATAATGAATTCTTGGTCA
TAAAAACAAGCTAGCAATTTACTCCTTAGCAATAAAAAATAATTGATAGTATCTTCAATG
CTTTAAATATATATAACAATAAATGA