Identifiers and Description

Gene Model Identifier

TTHERM_00328610

Standard Name

None

Aliases

PreTt30265 | 33.m00277 | 3705.m00104

Description

hypothetical protein; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF02532 ) Photosystem II reaction center I

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00328610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08561.12.000383902553626e-98leucine rich repeat family pro
tein (254 aa)
DictyBaseDDB_G02810911.9999391735788327e-19DDB_G0281091 on chromosome: 3
position 4039994 to 4042224
OxytrichaContig13298.0.g981.999598840915195e-17Leucine Rich repeats (2 copies
)
WormBaseWBGene000093670.0000000000010000211161514907Acidic leucine-rich nuclear ph
osphoprotein 32-related protei
n 1 status:Confirmed UniPr
ot:O62220 protein_id:CAB0426
5.1
Stentor CoeruleusSteCoe_313940.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00328610(coding)
ATGTCTTAAGATATTTTTGAATTAATTGAAGAATAAACCCAAAACAATGACCCCAACACA
ATCGAAGAACTCGTTTTGGACAAGTCTAAGATTGGCAAATTTACTGAAGAAATTAAAAAG
AAGTTAGAATCCTTCCCCAACTTGACATCCCTCTCTTTGAACGAATGTGAAATCACCTCT
TTGGAAAATTTCCCTAAGCTTCCTAAATTGATTAGAGTTGAGTTGATTGATAATAAAATT
ACAGGTTAATAACTCAAGCATTTACTCCACTTAAGTGAATTACAATCTCTCTCTTTGGGC
GGTAATCTCATTAAGAACCTCAAGGAAATCGATGTCCTCTAATAACTCCCTAAACTTTTC
TAACTTGATTTCCTCAACAACGATGTAGCTTAAGATCCTAACTACAGAGAATACGTATTT
TCTACTTTGAAGGGTCTTGGAATCCTTGATAACTATGATAGCAAGGGTCAAGAAGTCCAA
TACGATGATGAAGACGATGAAGATGGTGATGATTAAGATGACGAAGACGAAGACGAAGAA
GATGATGAAGATGAAGATGAAGGCGATGAAGGTGATGATGATGAAGAAGGTGTTAACTAA
AACGAAGAAAGTGATGATGATGAAGAAGTCGAAGAAGAAGAAGGTGACGAAGAATTCGAC
GAAGGTGCTGATGACGATGATGCTGAAGATGAAGAAGATGATGATGATGCTGAAGCCATT
GAACAAAAATCTACCCAAAAGAAGAAAGTTAAACCTAATTGA


>TTHERM_00328610(protein)
MSQDIFELIEEQTQNNDPNTIEELVLDKSKIGKFTEEIKKKLESFPNLTSLSLNECEITS
LENFPKLPKLIRVELIDNKITGQQLKHLLHLSELQSLSLGGNLIKNLKEIDVLQQLPKLF
QLDFLNNDVAQDPNYREYVFSTLKGLGILDNYDSKGQEVQYDDEDDEDGDDQDDEDEDEE
DDEDEDEGDEGDDDEEGVNQNEESDDDEEVEEEEGDEEFDEGADDDDAEDEEDDDDAEAI
EQKSTQKKKVKPN


>TTHERM_00328610(gene)
ATGTCTTAAGATATTTTTGAATTAATTGAAGAATAAACCCAAAACAATGACCCCAACACA
ATCGAAGAACTCGTTTTGGACAAGTCTAAGATTGGCAAATTTACTGAAGAAATTAAAAAG
AAGTTAGAATCCTTCCCCAACTTGACATCCCTCTCTTTGAACGAATGTGAAATCACCTCT
TTGGAAAATTTCCCTAAGCTTCCTAAATTGATTAGAGTTGAGTTGATTGATAATAAAATT
ACAGGTTAATAACTCAAGCATTTACTCCACTTAAGTGAATTACAATCTCTCTCTTTGGGC
GGTAATCTCATTAAGAACCTCAAGGAAATCGATGTCCTCTAATAACTCCCTAAACTTTTC
TAACTTGATTTCCTCAACAACGATGTAGCTTAAGATCCTAACTACAGAGAATACGTATTT
TCTACTTTGAAGGGTCTTGGAATCCTTGATAACTATGATAGCAAGGGTCAAGAAGTCCAA
TACGATGATGAAGACGATGAAGATGTAAGAAGTTTTTAATTTTTTAACCACATTTAAGAT
CGATATCAATGATCATTTGACTATTTTTAACTTTTTTGAGTTTTCTAAATTTCATGATTC
ATTTTGTGAGTTTAAAAGGATAGTAGATAAATATTTTATTTCGAAAATACCCCCCTATAA
ATTATACAATTTCCAAAAAAATGCTGCACAAAAACAGACTTTTCAGTTTTAGTTTCTAAA
TATTGATTTTTTTTTTTACTATCTTTAAGGGTGATGATTAAGATGACGAAGACGAAGACG
AAGAAGATGATGAAGATGAAGATGAAGGCGATGAAGGTGATGATGATGAAGAAGGTGTTA
ACTAAAACGAAGAAAGTGATGATGATGAAGAAGTCGAAGAAGAAGAAGGTGACGAAGAAT
TCGACGAAGGTGCTGATGACGATGATGCTGAAGATGAAGAAGATGATGATGATGCTGAAG
CCATTGAACAAAAATCTACCCAAAAGAAGAAAGTTAAACCTAATTGA