Identifiers and Description

Gene Model Identifier

TTHERM_00327030

Standard Name

None

Aliases

PreTt30206 | 33.m00218 | 3705.m00046

Description

IQ calmodulin-binding motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00612 ) IQ calmodulin-binding motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00327030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_52370
Tetrahymena borealisEI9_08616.19.997093137033517e-262IQ calmodulin-binding domain-c
ontaining protein family prote
in (1121 aa)
OxytrichaContig1188.1.g679.997093137033517e-262MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00327030(coding)
ATGAATTCAGAAGATTTAGGAAAAATAATTGTAAATGCATAGGATGAAATTCAAAGTTTA
AAAAAGAAGCTCGACTTTATAGCCACTGCAAAAAATACTCAGCAAGGAAATGGAAATGTA
GCAGAAGCTTAAGATATATAAAACATTTATCAAAGATTAACCTATACAATAAAAAAATTT
GAGAACTCAATATAAACCAACGTTGATAGGCTTCTCACTCACAATATGGCTCGACCTGAT
TCAGTCCCTTAGAAATTTCCTTCTATTAACAAAACAATAGATTCATAGTAGCACTTTTAA
TCGACAGCGAAAAATCAAAGCGTTTTGGCAAATACAAATAACTTTTAGAGCTTAAATGAA
AATAGTGAATATCAACCTTTTTATTTACCTTAACAGAAACGATACCAAAAGTAGCCTTTA
GGTTAAGGTAGTAATTCAGTAATTAAGCAAAATTAAAATAAGTCTTTTGAATATAGTAGA
AATTAAAAGGATTTCTCCTTTTAGAAAGTAGCTGATAAAAGCTTTGAAATAGGAAGGAGT
TATCTGAATAAAAATGTTATGGATTTACCCAGATAAAAAAGTATGAGTATGCATAATACA
AATGCTATAACTACTGCTAAGGACAAATCTTCATACTAAAAGCAAAAGCTAAAGCTTGGA
AGATTTTCAAAACCAGCCTCAGTTTTACCTCCTGAGATTAGAAACAACCCTTTTGCTGAT
GCTGTTGCAATTACAGAATCTGAAATATATAATGGTTTATACAATCTTATAAACAAAGGA
GTCGTTCCTAAAGATGTAGATATTATGCCAGCTTTTTCGAGAGGTGTTCCACCACTTATA
AATAAACCAATGATAATGCATGAGTTTAAGGAAAAGCTGATAAAATAAGAAATTAATATA
GAACCTAAAATAGATTTAATAAATATAAAATTAGATGTTTAGGCAATTCAGCCAAAGCCT
AAATAAGATCAAAAAGTGTAAGAATAAGCCCAAGCATCTTAAAACTCTTTTTAAAGAAAG
AGCTTTAAATTTAAATAATTTGTTCCTTCAAATAAGCTACTTGACTAAAGTGCAAATCAT
GATTTAAATTAATCAAAAAGATAGGATGATTTTGAACTTACATTAAAAGAGACCTAAGCA
AAAACATATCCTGAAGTTCTTGATGCGTATTCTTTGCATCATTTAATTGTAAGAAAGGCA
AAAGTTTTAGAAGAGACTCCTGAATATGCCTCTTATAAGCGTATTTATTAACTTTAATGG
GGATAAATAAATTAGCTACTCAAGGAAATTGAATAAATTGCTAAGTAATTTGATTTTCCT
ATGTTTTATCTAGATGGTAAAAAACTTGCTTAATTAAGCGAAAAAATAACCAAACCTACT
CTAGAAGAGCTATTAAATTGTATAGTTAATTAAGATATGGTTGATGAATTTGTCAAGTTG
CCTAAGAGAAAGTATAAAGGAGAAAAAGGAAAATTACTTGCTGTTGTAAAGATTTAGTCA
ATAATTAGAATGTTTCTTTAATACAGAGAATACAAAAGGATAAAATAAACTATACAAATA
GTTAAGATAATATAAAAGTATGCTAGGTTATATCTTCATAAAAAACAAACTAAAAAATTG
ATAAAGCTAAAAAATGAACAGCTATTTGATAAATTTAAGCAAACATTACATTAGTTTAAA
TTAGATTGGCCAGAAATAAAACTCAAAAAGAGGTTCGAAATTCATATTAACTCTTTCTCA
GTTGATGAGTTGAAGAGACTAACGATGGATAAATAGTTACAAAGAGAGAATATTTAAATA
ACAAGAATATTCCAAATAAAAGATCCTATGGTTTCTATTATTTATGTCTGCCCCTTTGGA
GTAAGTGACGACATTACAAATTATTATTACAAAATTCTTGAATTAGGAGATGTATAAAAC
TTTAAAGATAGATTGTATTTCATTAAACCTGAAAATTGTGACACATTCCCTTTTCACTTT
TCCCTTTCTAAAAAATTGTTATACTCTCCTTAAGCACTAAAAAGAATCAAAAAGTTAATT
AAAGGAAAATAAGGCTACATCGTTCCAGGATATCCTTCGAATGATGACATAAAACTTGCC
ACCGAACTTAATATACCAATTATGGGAGGAGACCCTTAAATTTCTTTTGTTAATTCAACA
AAATCTGCAGCAAGGAGAATATTCCATTCTTGTAAAATAGATGTTCCTCCTGGAGCATTT
GAAATTTATGATGAAACCGAATTCATAAATACTCTAACAGTACTAATAGCAAATAATCCA
GAAATAAGCACGTGGGTACTTAAAATTGATGATGAGTTCTAAGGAAGAGGTTTAGCTTAT
TACAATGTTGATTCTATAAACCAATTATCGGACTTGCTAAAATAATACTCTGAGGTTACT
GAAGAAATCATATAAAAAATAAAGTAAATAGTAAGTAAAACTTTAGCTTCAAAAGTAAAA
ATTGCAATGCCTACTCTTTACAAAGACTACAAAGAATATTTGTCTTGCTTTTTAAGAAGA
GGAGGAATAATTGAAGCCTACCCTGTTTTATTGAATAGAACTGTTATTTCTTCTCCTTCT
TTATCATTTTTTATAGAACCAAGTGGTGAAGTTAGTTTAATTACTGCTTATGATAAAATT
CAAGGGAGCTTATTTATAAATATAGGTTGCTCCTTTCCATAAAAGTCGATTACATCTAAC
ATAAATCTAACAAATTTGTGTTCTGAAATAGGCTCTAAATTGTATGAAAAAGGTGTTTTT
GGTTATGTAACTGCTGATTTCATAGTATATGGAGATACAATACAAGGTATAGGCTTAGAT
TGTTATATGAATAATTACTAAGCATCTTTCTTTTATTTTGACTATTTAATGAGAGGAAAG
CTAAATAAGGAAAATGGAAAATATTTTGCAAGTTTGACAGAAAATTTGGATAATTATTAA
TCCCTATCTGTTTTGGAAACAAGCAAACTTGAAGAGAGAACATATTTTTATTGCCCATTC
GTTAATCATCCTGGACTTTAAAATGTTAAGATTAAAAATTTCTTCTAAATGTGTAGATTT
GAAGCTATATAATTTGATCTTGAGAAGAAATATGGGGCTACATTTTTATTAGTTGATATA
CTCTAAGCTGGTGGTTTGGGGGTTTTGACTATTGGCGATGATTATAAAACTGCACTTAAA
CTTATGAATTTATCCCTTAATTTCTTAATGAAATAAGCTGGAAGTGTTAGTAAGAGCTAC
TCTGATGCTTATGGATAATCAAGAACTGATTGCATTAGCATTGTAGATGTTATTAGCAGA
ATCAGAATAATGACAAAAAAAATAGAAAAAGAAAATTTATACAATTTAAGCACAAAAATA
AATTATCAATCTCAAAAGTGA


>TTHERM_00327030(protein)
MNSEDLGKIIVNAQDEIQSLKKKLDFIATAKNTQQGNGNVAEAQDIQNIYQRLTYTIKKF
ENSIQTNVDRLLTHNMARPDSVPQKFPSINKTIDSQQHFQSTAKNQSVLANTNNFQSLNE
NSEYQPFYLPQQKRYQKQPLGQGSNSVIKQNQNKSFEYSRNQKDFSFQKVADKSFEIGRS
YLNKNVMDLPRQKSMSMHNTNAITTAKDKSSYQKQKLKLGRFSKPASVLPPEIRNNPFAD
AVAITESEIYNGLYNLINKGVVPKDVDIMPAFSRGVPPLINKPMIMHEFKEKLIKQEINI
EPKIDLINIKLDVQAIQPKPKQDQKVQEQAQASQNSFQRKSFKFKQFVPSNKLLDQSANH
DLNQSKRQDDFELTLKETQAKTYPEVLDAYSLHHLIVRKAKVLEETPEYASYKRIYQLQW
GQINQLLKEIEQIAKQFDFPMFYLDGKKLAQLSEKITKPTLEELLNCIVNQDMVDEFVKL
PKRKYKGEKGKLLAVVKIQSIIRMFLQYREYKRIKQTIQIVKIIQKYARLYLHKKQTKKL
IKLKNEQLFDKFKQTLHQFKLDWPEIKLKKRFEIHINSFSVDELKRLTMDKQLQRENIQI
TRIFQIKDPMVSIIYVCPFGVSDDITNYYYKILELGDVQNFKDRLYFIKPENCDTFPFHF
SLSKKLLYSPQALKRIKKLIKGKQGYIVPGYPSNDDIKLATELNIPIMGGDPQISFVNST
KSAARRIFHSCKIDVPPGAFEIYDETEFINTLTVLIANNPEISTWVLKIDDEFQGRGLAY
YNVDSINQLSDLLKQYSEVTEEIIQKIKQIVSKTLASKVKIAMPTLYKDYKEYLSCFLRR
GGIIEAYPVLLNRTVISSPSLSFFIEPSGEVSLITAYDKIQGSLFINIGCSFPQKSITSN
INLTNLCSEIGSKLYEKGVFGYVTADFIVYGDTIQGIGLDCYMNNYQASFFYFDYLMRGK
LNKENGKYFASLTENLDNYQSLSVLETSKLEERTYFYCPFVNHPGLQNVKIKNFFQMCRF
EAIQFDLEKKYGATFLLVDILQAGGLGVLTIGDDYKTALKLMNLSLNFLMKQAGSVSKSY
SDAYGQSRTDCISIVDVISRIRIMTKKIEKENLYNLSTKINYQSQK


>TTHERM_00327030(gene)
ATGAATTCAGAAGATTTAGGAAAAATAATTGTAAATGCATAGGATGAAATTCAAAGTTTA
AAAAAGAAGCTCGACTTTATAGCCACTGCAAAAAATACTCAGCAAGGTTTTTTTTATTAT
CATTTAGCAGATTTATCATTAATTTACTCAATATAGCTAAAAAATATGATTAAATATATT
TATTTTGTGGTAATTAATTAAGGAAATGGAAATGTAGCAGAAGCTTAAGATATATAAAAC
ATTTATCAAAGATTAACCTATACAATAAAAAAATTTGAGAACTCAATATAAACCAACGTT
GATAGGCTTCTCACTCACGTAATTATGCTATGCAATCTTTTTTTATATTAGCAATTTTAT
ATCGTTAAAATTTTATTAAAAAAATTATGTTTTTTGACTTTAGAATATGGCTCGACCTGA
TTCAGTCCCTTAGAAATTTCCTTCTATTAACAAAACAATAGATTCATAGTAGCACTTTTA
ATCGACAGCGAAAAATCAAAGCGTTTTGGCAAATACAAATAACTTTTAGAGCTTAAATGA
AAATAGTGAATATCAACCTTTTTATTTACCTTAACAGAAACGATACCAAAAGTAGCCTTT
AGGTTAAGGTAGTAATTCAGTAATTAAGCAAAATTAAAATGTAAAAAAACTAAAAAATAT
TTTAATATAAAATAATTATTTAAAATTTTAAATAGAAGTCTTTTGAATATAGTAGAAATT
AAAAGGATTTCTCCTTTTAGAAAGTAGCTGATAAAAGCTTTGAAATAGGAAGGAGTTATC
TGAATAAAAATGTTATGGATTTACCCAGATAAAAAAGTATGAGTATGCATAATACAAATG
CTATAACTACTGCTAAGGACAAATCTTCATACTAAAAGCAAAAGCTAAAGCTTGGAAGAT
TTTCAAAACCAGCCTCAGTTTTACCTCCTGAGATTAGAAACAACCCTTTTGCTGATGCTG
TTGCAATTACAGAATCTGAAATATATAATGGTTTATACAATCTTATAAACAAAGGAGTCG
TTCCTAAAGATGTAGATATTATGCCAGCTTTTTCGAGAGGTGTTCCACCACTTATAAATA
AACCAATGATGTAATTTATATATTTACCATAAATGAGATAAAATATATTCACAAATTAAA
AGAATAATTTTCAATTTTAATAAAATTATAATTTGATATTATTTAATTAACTAAAAAATT
TAGCTATTAGAAATATATTTATTACATTATATAAATAGTTTTCTTTATAATTTATTATTA
ATAGAATGCATGAGTTTAAGGAAAAGCTGATAAAATAAGAAATTAATATAGAACCTAAAA
TAGATTTAATAAATATAAAATTAGATGTTTAGGCAATTCAGCCAAAGCCTAAATAAGATC
AAAAAGTGTAAGAATAAGCCCAAGCATCTTAAAACTCTTTTTAAAGAAAGAGCTTTAAAT
TTAAATAATTTGTTCCTTCAAATAAGCTACTTGACTAAAGTGCAAATCATGATTTAAATT
AATCAAAAAGATAGGATGATTTTGAACTTACATTAAAAGAGACCTAAGCAAAAACATATC
CTGAAGTTCTTGATGCGTATTCTTTGCATCATTTAATTGTAAGAAAGGCAAAAGTTTTAG
AAGAGACTCCTGAATATGCCTCTTATAAGCGTATTTATTAACTTTAATGGGGATAAATAA
ATTAGCTACTCAAGGAAATTGAATAAATTGCTAAGTAATTTGATTTTCCTATGTTTTATC
TAGATGGTAAAAAAGTAGATTATTGCTTATAATATTTTTCTTATTGCTAACCATTTTTAA
AATTAAATTTAGCTTGCTTAATTAAGCGAAAAAATAACCAAACCTACTCTAGAAGAGCTA
TTAAATTGTATAGTTAATTAAGATATGGTTGATGAAGTAATTTTTATTTTTCAAAGCTTA
GTAAAAAATTTACAATTTCTAAAATAATTAAAAGTTTGTCAAGTTGCCTAAGAGAAAGTA
TAAAGGAGAAAAAGGAAAATTACTTGCTGTTGTAAAGATTTAGTCAATAATTAGAATGTT
TCTTTAATACAGAGAATACAAAAGGATAAAATAAACTATACAAATAGTTAAGATAATATA
AAAGTATGCTAGGTTATATCTTCATAAAAAACAAACTAAAAAATTGATAAAGCTAAAAAA
TGAACAGCTATTTGATAAATTTAAGCAAACATTACATTAGTTTAAATTAGATTGGCCAGA
AATAAAACTCAAAAAGAGGTTCGAAATTCATATTAACTCTTTCTCAGTTGATGTAAATGA
TCAAATACTTATTTATTTACAATTTAAAAAAATTTAACAATTTTATAAATAAAAAGTTTT
GTTTGAAATTAATTTAATCCTCAACAACCTTTGTAAATTATATTTAAAATTATCTATAAA
ATAAATTAGGAGTTGAAGAGACTAACGATGGATAAATAGTTACAAAGAGAGAATATTTAA
ATAACAAGAATATTCCAAATAAAAGATCCTATGGTTTCTATTATTTATGTCTGCCCCTTT
GGAGTAAGTGACGACATTACAAATTATTATTACAAAGTAATTAGATGATATTAATTAGAA
AGAAAATTTTAACTTTATTTGTAATAATTAATTATTTTTTTATTAAAATTTAATATTCAA
AATTAGATTCTTGAATTAGGAGATGTATAAAACTTTAAAGATAGATTGTATTTCATTAAA
CCTGAAAATTGTGACACATTCCCTTTTCACTTTTCCCTTTCTAAAAAATTGTTATACTCT
CCTTAAGCACTAAAAAGAATCAAAAAGTTAATTAAAGGAAAATAAGGCTACATCGTTCCA
GGATATCCTTCGAATGATGACATAAAACTTGCCACCGAACTTAATATACCAATTATGGGA
GGAGACCCTTAAATTTCTTTTGTTAATTCAACAAAATCTGCAGCAAGGAGAATATTCCAT
TCTTGTAAAATAGATGTTCCTCCTGGAGCATTTGAAATTTATGATGAAACCGAATTCATA
AATACTCTAACAGTACTAATAGCAAATAATCCAGAAATAAGCACGTGGGTACTTAAAATT
GATGATGAGTTCTAAGGAAGAGGTTTAGCTTATTACAATGTTGATTCTATAAACCAATTA
TCGGACTTGCTAAAATAATACTCTGAGGTAATTAATTAATTAACTATAAATTAATCCTTA
TTTTAAGATAGATTAGTTTATTAATGTTTTTGATAATAAGATAAATATTAATTATTTAAC
CATTTAAAAGGTTACTGAAGAAATCATATAAAAAATAAAGTAAATAGTAAGTAAAACTTT
AGCTTCAAAAGTAAAAATTGCAATGCCTACTCTTTACAAAGACTACAAAGAATATTTGTC
TTGCTTTTTAAGAAGAGGAGGAATAATTGAAGCCTACCCTGTTTTATTGAATAGAACTGT
TATTTCTTCTCCTTCTTTATCATTTTTTATAGAACCAAGTGGTGAAGTTAGTTTAATTAC
TGCTTATGATAAAATTCAAGGGAGCTTATTTATAAATATAGGTATGTATTTCTTTAATTA
ACAAATAAAAATTCTAAAAATATTTTATTTTAAAGGTTGCTCCTTTCCATAAAAGTCGAT
TACATCTAACATAAATCTAACAAATTTGTGTTCTGAAATAGGCTCTAAATTGTATGAAAA
AGGTAAATAAATAAATAACTAAAAAATTAATAATTTAAAATAATTAATTAATAAAAAGGT
GTTTTTGGTTATGTAACTGCTGATTTCATAGTATATGGAGATACAATACAAGGTATAGGC
TTAGATTGTTATATGAATAATTACTAAGCATCTTTCTTTTATTTTGACTATTTAATGAGA
GGAAAGCTAAATAAGGAAAATGGAAAATATTTTGCAAGTTTGACAGAAAATTTGGATAAT
TATTAATCCCTATCTGTTTTGGGTAATTTTATAAAATTTCAATTTTTTATAAAAATTTTT
TTTTTTTTGAATGAAGAAACAAGCAAACTTGAAGAGAGAACATATTTTTATTGCCCATTC
GTTAATCATCCTGGACTTTAAAATGTTAAGATTAAAAATTTCTTCTAAATGTGTAGATTT
GAAGCTATATAATTTGATCTTGAGAAGAAATATGGGGCTACATTTTTATTAGTTGATATA
CTCTAAGCTGGTGGTTTGGGGGTTTTGACTATTGGTAAATAATATTTTGTTTTTAGAGCT
TTAATAACTAAAAATATCATATAAAAAAGGCGATGATTATAAAACTGCACTTAAACTTAT
GAATTTATCCCTTAATTTCTTAATGAAATAAGCTGGAAGTGTTAGTAAGAGCTACTCTGA
TGCTTATGGATAATCAAGGTAATTAAATTTGTTTGAAACTCTAATTAAGCTTACAATAAT
TATTTAAAAAAAGAACTGATTGCATTAGCATTGTAGATGTTATTAGCAGAATCAGAATAA
TGACAAAAAAAATAGAAAAAGAAAATTTATACAATTTAAGCACAAAAATAAATTATCAAT
CTCAAAAGTGA