Identifiers and Description

Gene Model Identifier

TTHERM_00326930

Standard Name

None

Aliases

PreTt30196 | 33.m00208 | 3705.m00036

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00326930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08625.19.997093137033517e-262kelch domain-containing protei
n family protein (1159 aa)
OxytrichaContig20663.0.g913.9989916100764785e-24Kelch motif
WormBaseWBGene000082670.000000000029994712494008525status:Partially_confirmed U
niProt:O17700 protein_id:CAB
03989.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00326930(coding)
ATGTTAGCTAGCAGAAACTATTCTCAATTTGGAGAAAACTCCTCACAAAATTCACGAAAC
ATGACTCCAAACTAATAGGTTATGGGTATACCAAAGATAATGTGTGGAGATCATTAGGGA
TTTTTTATCACTCACTTTTGTAGTAAGATTTAATGCTTGAAAGGGTTATGCTAAAAATGT
ATAAAAGAGCATAATCAATATCATAAAGACAGAAAAGAATATGCCGAAATCGAAACGCTA
GAAGACATAAGCTCAAATTGTCAATAGAAAATACACACTTGCTTGAAAGATTATACAGAA
GAATAAGAAAATATTCAGCAACAAATCAAATCAGAGGAGTAACATCATAAATCGCAATAA
GTACTATAGAAAATGAGCGAAGCAGAAAGCTAATGCCAAAATATTGTCTAAAGCTACTTC
AAAACAGTAAGAAAGGAGTATGAAATAGCATTAAGAAAAATGGATGCTGAAAAACAAAAA
ATGAATAAATAGCTTTAGGAAATAGAAAATGAAAAAAATAAACTTAACGGCTTCCTACGT
GAGCTGCAAGAAAATCAATTTCAAATTAGTACTCTTTAGCATTTACTTAAGCTAGATTTT
AGTATTTTCATAAATGAAAAGCTAGGTGTAATAGGTTAATATTTTGAGTAGCTGATATCA
GTTACTCCAAGCATTACCATAAATTTTGAAAACGTTCATAGATAAATTTATGAAATCTGC
TAAAACACTTGTTTCTTAACATATTCTGGATAGTCTCCTAAATAAAAAAGCATCACACAA
TTAAGGTAAGAGATATCTATCAATAATCGCAAGGCAAGCACTCCATCAAATTTTAATGGC
ACAAGTGAATAGAATGGAAATTCTCAACGTCATATCTCACTTTCTCCTTTTAAATCTAAT
AACTTTAATGTTCCTCTTACATAACAAATTAATTTTAAAGACAGCAGTTAATTTTCTTAG
AATTCTGAGCGTAGTTATAATGAGTTTTCTGGAATGCAGTAACAAAGAAATAAGAGCTAT
TCTCCAGCTCCTGACAGTAGGGTAGTAGCTTAATAAACTTCATCTGTAGTTAGACCTAAC
TAATAACCTAAGATACCTATTTTAAATAATGTAGAAAACAGCTAATCGCAGCAGGATGAT
AAATACACACCAGTTAGCAAGAAAATGAAGATGAAAATATTTGATACTAAACCTAATCTT
TTGTCATCACCTAGACCTCCAACTAATTCGAATTAATAATCTTTAAAAAGCTCAGTAGCT
AGAACAATCGGAGAAAACAAAATTAATGGCTAATATCAAAGTAATATCTTGTAATCTAAT
AACATAAACAATGTGCACTCTTCTTAGAATATAACTCCTAACTTTTTGACTGGCAAAAAT
AGTAATGCTTAAAACACTGGTTTTTCTAGCTTTAACTCAAACACTCCTTAATCATTTAAC
CCTCAAAATGAAAATCAGATATCCTCTTTAAACAACTTAAGCAGCAACAATAAATTTGCA
GAAAACAACAAAAATTTAATCCCTTAGTAATCTAATTTTGCAAATATTAAGTTTAATCCT
ACTCCAAGAAATGAAATTCAAATAAACTCAAATGATATTCCTTAAAATTAATAGCTTTAA
TTCAGTAGAAATGAGCTTTTAAACAATAACTAGTCATAAGCAGGTTTAGCTTAAAATCAA
TTGACAGCAGGCTATCCTTAATCTTAGTTCGGCCAAAGTATTTAACTGAGCTAGTATAAT
AATAACAACAGTAATATAGGAGGTAACAATCTTTTCTAATAAGATATAAACAATAGTAGC
ACTTCATAAATGAAAAATATGAATGAAGTTAGCTCTTCTAATTTTAATAGAGGAAATTCT
TTCAACCCTTCACAAGCTTAAGATAAAGATAACTACAGCTATTCCAATAATAACATTAAT
ATGCTATAGCATATCCCTTAAAAATATAAATAAGTTTAAAATGTAAATTAATTCATTCCA
GAAGAGTCCTAAGACTATTAACAAGAATCTTAGAACTTAGGCCTGAATCGAAATAATCAT
AATCAACAATTTAATAATATTTAGTCCCCTCAAAACGATATTTATGGAATTTCAGCTTAA
AATATTACAAGTAACATTCCTTAATAATATAATTCGTAATATAATCCTTAGAGTTAGTAA
TAATCAACCATAAACAATAATCCTAATCACAAAAAAAATAATCAAGAAGATGCTTTTAAT
ACAAATAACATGAATAGCCACAGGTAAATAGAAGTAAAGGACTCAAGATAAAAAGACTTC
TAGGTATAAATGGCTAATTACCTAAAGTAAGAAAGCAATTACCAATATCTACATTTCTTC
CAGCCTAAAAGCAATATTCTTCATATTGTTAATATACAGGATGTTAAATAAGCTTCAAAT
GGATCATCACAAAGTAGTTATTTGAAATTCTATTAAATACAAATGAAGACTGATGATCCT
TCATTCACTGTACCTAGATTCCATAAATCTATTACACTCCGCGATGGAAGCATTTATTTA
ATGGGTGGAGTTTCGCCTTCATCTAACCACTCTAAAACAGTCTATAAATATGAATTTACA
AAAAATAAACTCTAAGCTGTTTCTGAGATGATAACAGGTAGAAGTGGATTTGGATGTGTT
TATTCTCCTTTTAATAATAGCATTTATGTAATTGGAGGCGCTTGTGACGAAGATGGCGTT
ACAAATCAATGTGAAAGATATGATCTCAATACTAACAAATGGAGTTCGATTTCTTACTTA
AATAATCCTACATTTAATCCTGCTGTTTGCTATTTCTAAGCTCCTAATGGAAAGAATTAT
TTATTCAAATTCGCTGGTAAAATTGATGATGATAATTTAGATACCACAATTGAGAGGTAT
GATTTGTAGAGTGATAGATGGGAAATTATACCAACTTAAACATAAATTCCTATTTTATTA
AGTAGTGCTAACTGTTGCTAGATTAACAGTAATAACATTTTGGTATTTGGTGGAGCATAT
ACATAATCTCAAGAAAAAGCAAGTACTTGCTTCTTACTTAATGTTAATCTTGATTCAATC
ACTAAAAACTAGCTTGTACATGAAATTAAAGGCATAAACCAAATAGAATTACCAAATTCT
GAGGGTTTTTCAAACTAACAATCATTTATTCATGACAACTAGCTTTATACAATACAAAAT
GTTTCTGAAAAGAAAAACCCTGAAATAATTTATCTAGACAGAAAAAGAATTATAAGCTTT
AATTCACAAAGTTGGATGGTCTTAAATAATATTGAACTATTAGAAAAAAATAGCTGA


>TTHERM_00326930(protein)
MLASRNYSQFGENSSQNSRNMTPNQQVMGIPKIMCGDHQGFFITHFCSKIQCLKGLCQKC
IKEHNQYHKDRKEYAEIETLEDISSNCQQKIHTCLKDYTEEQENIQQQIKSEEQHHKSQQ
VLQKMSEAESQCQNIVQSYFKTVRKEYEIALRKMDAEKQKMNKQLQEIENEKNKLNGFLR
ELQENQFQISTLQHLLKLDFSIFINEKLGVIGQYFEQLISVTPSITINFENVHRQIYEIC
QNTCFLTYSGQSPKQKSITQLRQEISINNRKASTPSNFNGTSEQNGNSQRHISLSPFKSN
NFNVPLTQQINFKDSSQFSQNSERSYNEFSGMQQQRNKSYSPAPDSRVVAQQTSSVVRPN
QQPKIPILNNVENSQSQQDDKYTPVSKKMKMKIFDTKPNLLSSPRPPTNSNQQSLKSSVA
RTIGENKINGQYQSNILQSNNINNVHSSQNITPNFLTGKNSNAQNTGFSSFNSNTPQSFN
PQNENQISSLNNLSSNNKFAENNKNLIPQQSNFANIKFNPTPRNEIQINSNDIPQNQQLQ
FSRNELLNNNQSQAGLAQNQLTAGYPQSQFGQSIQLSQYNNNNSNIGGNNLFQQDINNSS
TSQMKNMNEVSSSNFNRGNSFNPSQAQDKDNYSYSNNNINMLQHIPQKYKQVQNVNQFIP
EESQDYQQESQNLGLNRNNHNQQFNNIQSPQNDIYGISAQNITSNIPQQYNSQYNPQSQQ
QSTINNNPNHKKNNQEDAFNTNNMNSHRQIEVKDSRQKDFQVQMANYLKQESNYQYLHFF
QPKSNILHIVNIQDVKQASNGSSQSSYLKFYQIQMKTDDPSFTVPRFHKSITLRDGSIYL
MGGVSPSSNHSKTVYKYEFTKNKLQAVSEMITGRSGFGCVYSPFNNSIYVIGGACDEDGV
TNQCERYDLNTNKWSSISYLNNPTFNPAVCYFQAPNGKNYLFKFAGKIDDDNLDTTIERY
DLQSDRWEIIPTQTQIPILLSSANCCQINSNNILVFGGAYTQSQEKASTCFLLNVNLDSI
TKNQLVHEIKGINQIELPNSEGFSNQQSFIHDNQLYTIQNVSEKKNPEIIYLDRKRIISF
NSQSWMVLNNIELLEKNS


>TTHERM_00326930(gene)
ATGTTAGCTAGCAGAAACTATTCTCAATTTGGAGAAAACTCCTCACAAAATTCACGAAAC
ATGACTCCAAACTAATAGGTTATGGGTATACCAAAGATAATGTGTGGAGATCATTAGGGA
TTTTTTATCACTCACTTTTGTAGTAAGATTTAATGCTTGAAAGGGTTATGCTAAAAATGT
ATAAAAGAGCATAATCAATATCATAAAGACAGAAAAGAATATGCCGAAATCGAAACGCTA
GAAGACATAAGCTCAAATTGTCAATAGAAAATACACACTTGCTTGAAAGATTATACAGAA
GAATAAGAAAATATTCAGCAACAAATCAAATCAGAGGAGTAACATCATAAATCGCAATAA
GTACTATAGAAAATGAGCGAAGCAGAAAGCTAATGCCAAAATATTGTCTAAAGCTACTTC
AAAACAGTAAGAAAGGAGTATGAAATAGCATTAAGAAAAATGGATGCTGAAAAACAAAAA
ATGAATAAATAGCTTTAGGAAATAGAAAATGAAAAAAATAAACTTAACGGCTTCCTACGT
GAGCTGCAAGAAAATCAATTTCAAATTAGTACTCTTTAGCATTTACTTAAGCTAGATTTT
AGTATTTTCATAAATGAAAAGCTAGGTGTAATAGGTTAATATTTTGAGTAGCTGATATCA
GTTACTCCAAGCATTACCATAAATTTTGAAAACGTTCATAGATAAATTTATGAAATCTGC
TAAAACACTTGTTTCTTAACATATTCTGGATAGTCTCCTAAATAAAAAAGCATCACACAA
TTAAGGTAAGAGATATCTATCAATAATCGCAAGGCAAGCACTCCATCAAATTTTAATGGC
ACAAGTGAATAGAATGGAAATTCTCAACGTCATATCTCACTTTCTCCTTTTAAATCTAAT
AACTTTAATGTTCCTCTTACATAACAAATTAATTTTAAAGACAGCAGTTAATTTTCTTAG
AATTCTGAGCGTAGTTATAATGAGTTTTCTGGAATGCAGTAACAAAGAAATAAGAGCTAT
TCTCCAGCTCCTGACAGTAGGGTAGTAGCTTAATAAACTTCATCTGTAGTTAGACCTAAC
TAATAACCTAAGATACCTATTTTAAATAATGTAGAAAACAGCTAATCGCAGCAGGATGAT
AAATACACACCAGTTAGCAAGAAAATGAAGATGAAAATATTTGATACTAAACCTAATCTT
TTGTCATCACCTAGACCTCCAACTAATTCGAATTAATAATCTTTAAAAAGCTCAGTAGCT
AGAACAATCGGAGAAAACAAAATTAATGGCTAATATCAAAGTAATATCTTGTAATCTAAT
AACATAAACAATGTGCACTCTTCTTAGAATATAACTCCTAACTTTTTGACTGGCAAAAAT
AGTAATGCTTAAAACACTGGTTTTTCTAGCTTTAACTCAAACACTCCTTAATCATTTAAC
CCTCAAAATGAAAATCAGATATCCTCTTTAAACAACTTAAGCAGCAACAATAAATTTGCA
GAAAACAACAAAAATTTAATCCCTTAGTAATCTAATTTTGCAAATATTAAGTTTAATCCT
ACTCCAAGAAATGAAATTCAAATAAACTCAAATGATATTCCTTAAAATTAATAGCTTTAA
TTCAGTAGAAATGAGCTTTTAAACAATAACTAGTCATAAGCAGGTTTAGCTTAAAATCAA
TTGACAGCAGGCTATCCTTAATCTTAGTTCGGCCAAAGTATTTAACTGAGCTAGTATAAT
AATAACAACAGTAATATAGGAGGTAACAATCTTTTCTAATAAGATATAAACAATAGTAGC
ACTTCATAAATGAAAAATATGAATGAAGTTAGCTCTTCTAATTTTAATAGAGGAAATTCT
TTCAACCCTTCACAAGCTTAAGATAAAGATAACTACAGCTATTCCAATAATAACATTAAT
ATGCTATAGCATATCCCTTAAAAATATAAATAAGTTTAAAATGTAAATTAATTCATTCCA
GAAGAGTCCTAAGACTATTAACAAGAATCTTAGAACTTAGGCCTGAATCGAAATAATCAT
AATCAACAATTTAATAATATTTAGTCCCCTCAAAACGATATTTATGGAATTTCAGCTTAA
AATATTACAAGTAACATTCCTTAATAATATAATTCGTAATATAATCCTTAGAGTTAGTAA
TAATCAACCATAAACAATAATCCTAATCACAAAAAAAATAATCAAGAAGATGCTTTTAAT
ACAAATAACATGAATAGCCACAGGTAAATAGAAGTAAAGGACTCAAGATAAAAAGACTTC
TAGGTATAAATGGCTAATTACCTAAAGTAAGAAAGCAATTACCAATATCTACATTTCTTC
CAGCCTAAAAGCAATATTCTTCATATTGTTAATATACAGGATGTTAAATAAGCTTCAAAT
GGATCATCACAAAGTAGTTATTTGAAATTCTATTAAATACAAATGAAGACTGATGATCCT
TCATTCACTGTACCTAGATTCCATAAATCTATTACACTCCGCGATGGAAGCATTTATTTA
ATGGGTGGAGTTTCGCCTTCATCTAACCACTCTAAAACAGTCTATAAATATGAATTTACA
AAAAATAAACTCTAAGCTGTTTCTGAGATGATAACAGGTAGAAGTGGATTTGGATGTGTT
TATTCTCCTTTTAATAATAGCATTTATGTAATTGGAGGCGCTTGTGACGAAGATGGCGTT
ACAAATCAATGTGAAAGATATGATCTCAATACTAACAAATGGAGTTCGATTTCTTACTTA
AATAATCCTACATTTAATCCTGCTGTTTGCTATTTCTAAGCTCCTAATGGAAAGAATTAT
TTATTCAAATTCGCTGGTAAAATTGATGATGATAATTTAGATACCACAATTGAGAGGTAT
GATTTGTAGAGTGATAGATGGGAAATTATACCAACTTAAACATAAATTCCTATTTTATTA
AGTAGTGCTAACTGTTGCTAGATTAACAGTAATAACATTTTGGTATTTGGTGGAGCATAT
ACATAATCTCAAGAAAAAGCAAGTACTTGCTTCTTACTTAATGTTAATCTTGATTCAATC
ACTAAAAACTAGCTTGTACATGAAATTAAAGGCATAAACCAAATAGAATTACCAAATTCT
GAGGGTTTTTCAAACTAACAATCATTTATTCATGACAACTAGCTTTATACAATACAAAAT
GTTTCTGAAAAGAAAAACCCTGAAATAATTTATCTAGACAGAAAAAGAATTATAAGCTTT
AATTCACAAAGTTGGATGGTCTTAAATAATATTGAACTATTAGAAAAAAATAGCTGA