Identifiers and Description

Gene Model Identifier

TTHERM_00326790

Standard Name

None

Aliases

PreTt30182 | 33.m00194 | 3705.m00023

Description

Protein NLRC3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01422 ) NF-X1 type zinc finger
  • ( PF08792 ) A2L zinc ribbon domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00326790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08642.19.997093137033517e-262hypothetical protein (453 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00326790(coding)
ATGAGCAGGAGAAAAGTTGGAGGAGTCATTAAAAAAGCTATTGAAAAGGAAGAAAAAGAG
CCTGTAAAGAAAGCTCCAAAAAAAAAACCTAGCAAGGCTGTGGTTTAGCAAGAATAAATT
ATGCTTAACATTGAAAATGCAAATACTACTTAGCACATTAAAGATTTATGTGATTAATTC
GAACCTCCCGCTTGCAAAAAATGCCCAAATAGAAATGCAGATCGTATTTGTGTGAATGCA
GAGTGTGGTCATAACAATTATCTTGAGTTAATTTGCGGTAAATGCCATTTCTAAAAACAC
AGCGAATGTAAAGAAAAACCTGAATTAGATGTTGAAGAATTCTTTATAAAGCTTGGCACT
TTTTTGAATGAAACAAAATTCAATTCATCTTTTGGGGAATAAGGAATTAATACTGAAAAA
CTTTAAGAAGCTTTTGCCTAAATTGACTTGTATAATTAAAAGCTTGATGAAATCGAATTG
GTTATCAAAAAAGAGATATTGACATATAAGACCCCTGAAGAAACCCACAATTCTATTGCC
AATAGTATTACAAAAGCAATCAGTGAGCCAACATTTGAAAACATATAAAATGAACTTGAG
AATATTAAATCATATGTTTTATTTGAGGATAACAATTTCAAGTCGAATGGAATCTCAGAA
AAGGCAAAATATTTGAGAGATTAGGTTAAGGCAATTAGTGAAGAAAATAAACTTTTAAGA
TAGACTATAAATTCCTCTTTTATAGGTGGAAGAAGCATAGATATTTCTGATCTTAAAATT
GAAGAAGGACTAAGCTAAAATTATAGAACTTAGAAAAAGTTAAAATGGTCATACAAAAAC
GGTTCTATTAACATCTAAAGTCAAGCAAAATCCTACTAATAATAAGTACATCTTGATTTT
GAGATTGATCCTTATAAAAAATATACTCTTCGTTGGACTGTTAACAGTTTTAATAATAAC
TATCACTTTGTTGGTTTGTTCAGAAAAGATTAAGTCAAAACCAATTATATGTATTCTGGT
ACATCTGGATATATATTTAAGAGATTTTACAATTAGAGCCCCACATAAGACTGCTCAGAA
GTAGTGAAAGGCATAGATTTTGGTTAGAGTGTATAAAACGGAAGCTAATACGAAATGAGA
TTCAGTATTTCAGACAATATTCTTTAGTTTTGCACTTATCCTGACTATGAAAATGTAGTG
TCAAAATTTGATTATGTTTCATTTGATAAAGATACAGAATACGTAATTACATTTAATATG
TATAATAACATGAATATATCTATAGATAGTCTTGAAGAGAGTTACTTCTTCCCATCATAT
TGA


>TTHERM_00326790(protein)
MSRRKVGGVIKKAIEKEEKEPVKKAPKKKPSKAVVQQEQIMLNIENANTTQHIKDLCDQF
EPPACKKCPNRNADRICVNAECGHNNYLELICGKCHFQKHSECKEKPELDVEEFFIKLGT
FLNETKFNSSFGEQGINTEKLQEAFAQIDLYNQKLDEIELVIKKEILTYKTPEETHNSIA
NSITKAISEPTFENIQNELENIKSYVLFEDNNFKSNGISEKAKYLRDQVKAISEENKLLR
QTINSSFIGGRSIDISDLKIEEGLSQNYRTQKKLKWSYKNGSINIQSQAKSYQQQVHLDF
EIDPYKKYTLRWTVNSFNNNYHFVGLFRKDQVKTNYMYSGTSGYIFKRFYNQSPTQDCSE
VVKGIDFGQSVQNGSQYEMRFSISDNILQFCTYPDYENVVSKFDYVSFDKDTEYVITFNM
YNNMNISIDSLEESYFFPSY


>TTHERM_00326790(gene)
ATGAGCAGGAGAAAAGTTGGAGGAGTCATTAAAAAAGCTATTGAAAAGGAAGAAAAAGAG
CCTGTAAAGAAAGCTCCAAAAAAAAAACCTAGCAAGGCTGTGGTTTAGCAAGAATAAATT
ATGCTTAACATTGAAAATGCAAATACTACTTAGCACATTAAAGATTTATGTGATTAATTC
GAACCTCCCGCTTGCAAAAAATGCCCAAATAGAAATGCAGATCGTATTTGTGTGAATGCA
GAGTGTGGTCATAACAATTATCTTGAGTTAATTTGCGGTAAATGCCATTTCTAAAAACAC
AGCGAATGTAAAGAAAAACCTGAATTAGATGTTGAAGAATTCTTTATAAAGCTTGGCACT
TTTTTGAATGAAACAAAATTCAATTCATCTTTTGGGGAATAAGGAATTAATACTGAAAAA
CTTTAAGAAGCTTTTGCCTAAATTGACTTGTATAATTAAAAGCTTGATGAAATCGAATTG
GTTATCAAAAAAGAGATATTGACATATAAGACCCCTGAAGAAACCCACAATTCTATTGCC
AATAGTATTACAAAAGCAATCAGTGAGCCAACATTTGAAAACATATAAAATGAACTTGAG
AATATTAAATCATATGTTTTATTTGAGGATAACAATTTCAAGTCGAATGGAATCTCAGAA
AAGGCAAAATATTTGAGAGATTAGGTTAAGGCAATTAGTGAAGAAAATAAACTTTTAAGA
TAGACTATAAATTCCTCTTTTATAGGTGGAAGAAGCATAGATATTTCTGATCTTAAAATT
GAAGAAGGACTAAGCTAAAATTATAGAACTTAGAAAAAGTTAAAATGGTCATACAAAAAC
GGTTCTATTAACATCTAAAGTCAAGCAAAATCCTACTAATAATAAGTACATCTTGATTTT
GAGATTGATCCTTATAAAAAATATACTCTTCGTTGGACTGTTAACAGTTTTAATAATAAC
TATCACTTTGTTGGTTTGTTCAGAAAAGATTAAGTCAAAACCAATTATATGTATTCTGGT
ACATCTGGATATATATTTAAGAGATTTTACAATTAGAGCCCCACATAAGACTGCTCAGAA
GTAGTGAAAGGCATAGATTTTGGTTAGAGTGTATAAAACGGAAGCTAATACGAAATGAGA
TTCAGTATTTCAGACAATATTCTTTAGTTTTGCACTTATCCTGACTATGAAAATGTAGTG
TCAAAATTTGATTATGTTTCATTTGATAAAGATACAGAATACGTAATTACATTTAATATG
TATAATAACATGAATATATCTATAGATAGTCTTGAAGAGAGTTACTTCTTCCCATCATAT
TGA