Identifiers and Description

Gene Model Identifier

TTHERM_00317010

Standard Name

None

Aliases

PreTt21001 | 31.m00303 | 3687.m00105

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00317010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08387.19.997093137033517e-262hypothetical protein (416 aa)
DictyBaseDDB_G02746871.999790113608142e-24DDB_G0274687 on chromosome: 2
position 4246508 to 4249696
WormBaseWBGene000113670.0000000000019997478866288316locus:snpc-3.4 status:Confir
med UniProt:Q22092 protein
_id:CAA84674.1
OxytrichaContig8018.0.g720.00000005001214305021125snRNA-activating protein of 50
kDa MW C terminal

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00317010(coding)
ATGAATAAAGATTAAAATGGGTTACAATTTGCCTATCCAGAAAACACTAGCATGTTTATA
AAAGATTTTTCTTAAAAGCTATTAATTAATTATAAATAGATAGAGAGCTGTGTTAGCGAT
TATAAATAGCAACTTCCCGATTCATATTATGACTGCTCTGATTTACAAATAAATCATGGT
GAAGACATGATGGAAAGGTATGTTGAATTAGAAATACCAGATAATGAAGATTTAAAAGAA
CATCTTAAAGCTTGCGGAGATGAAGCAAGCAAAAAAAATATTATTTTGAATTCTTAAAGT
CCATACTAGCTAGTTTAAGATGCCAAAGAAAATATAAAAGACATGAAAAAAGAATCAATA
AATTTATCAGTACTTGTTGATAAATTGAAGGTTCCTATTTTTACTCAAGATATTTCTTAG
CAAATATCAGTTTTGGAGTCTTTTAAAGTATTAGAGAAGAAAGAAGTTAAGATTAAAGCT
TTGTGTAAAAACATGATGGATAGACCTATTTAAAAAGCAATAGAAGAAGAAAAGAAAAGA
TTCATTCCTATTGAGAAAAAACTAGACACAAATCACACAATAATAAAAGTTTCTGTTTAT
AACAGCATCAATGGATTAAAGCAAAACGAATATTTAGTATACGATATTTAATTTTTGTAA
GATTTAGTTTTTAAAATTGAATGTCTTTCAGAAAAACTCTCTGAAAGAATTCCGAGTGGA
CAACAATCCCAGCCTGACTCAAAGTTTATGAAACCCTCATTCTTATTTATAGAAAATACT
TTTTACAACAACCAATACAAGATAGATGTTAAAAACCTATACCATGAATGGCAGCAAGAA
GCAAAAATAAACTCTCAAAATAGTGGAATGCAGTTTGAAGAAGAATTTGAAGAAAAAACC
TTAAATGAAATGTTTGAGTAAATTAAAATACAAATAGGTAAGCCATATGTATTTAGACAT
TAAAATAAATGTGATCACATGATTGTTTTTAATGAAATACGTCTATGGAATACAGATCTG
CCAGCTGATAAAGATCTGTACCCCTTCAATGTTTTTCTGCCTAAAGTAAAAAGAAGAAAA
TGTGATGGATGCAACTTATTCTTTACAGAGATCGTTTGCTTCAATGATAAAGTTTCATCT
AAAAATCCTATTTTTCTATGTGAAAAGTGTTTTAATCAAACCCATATCAATTGGAAAAAA
GAATTAAGATATAACGATTTCTCATATTATCCATACATTTATGAATGA


>TTHERM_00317010(protein)
MNKDQNGLQFAYPENTSMFIKDFSQKLLINYKQIESCVSDYKQQLPDSYYDCSDLQINHG
EDMMERYVELEIPDNEDLKEHLKACGDEASKKNIILNSQSPYQLVQDAKENIKDMKKESI
NLSVLVDKLKVPIFTQDISQQISVLESFKVLEKKEVKIKALCKNMMDRPIQKAIEEEKKR
FIPIEKKLDTNHTIIKVSVYNSINGLKQNEYLVYDIQFLQDLVFKIECLSEKLSERIPSG
QQSQPDSKFMKPSFLFIENTFYNNQYKIDVKNLYHEWQQEAKINSQNSGMQFEEEFEEKT
LNEMFEQIKIQIGKPYVFRHQNKCDHMIVFNEIRLWNTDLPADKDLYPFNVFLPKVKRRK
CDGCNLFFTEIVCFNDKVSSKNPIFLCEKCFNQTHINWKKELRYNDFSYYPYIYE


>TTHERM_00317010(gene)
ATGAATAAAGATTAAAATGGGTTACAATTTGCCTATCCAGAAAACACTAGCATGTTTATA
AAAGATTTTTCTTAAAAGCTATTAATTAATTATAAATAGATAGAGAGCTGTGTTAGCGAT
TATAAATAGCAACTTCCCGATTCATATTATGAGTAATTCTATTTTGGATTCTTAATTTAA
ATTTAATCATTTACAATAATATTTTAAAAGCTGCTCTGATTTACAAATAAATCATGGTGA
AGACATGATGGAAAGGTATGTTGAATTAGAAATACCAGTAAGATTATTAATTAAATGTTT
TAAGAGGTAGATTTTAATAATATTTTAATTTTTAAATCAGGATAATGAAGATTTAAAAGA
ACATCTTAAAGCTTGCGGAGATGAAGCAAGCAAAAAAAATATTATTTTGAATTCTTAAAG
TCCATACTAGCTAGTTTAAGATGCCAAAGAAAATATAAAAGACATGAAAAAAGAATCAAT
AAATTTATCAGTACTTGTTGATAAATTGAAGGTTCCTATTTTTACTCAAGATATTTCTTA
GCAAATATCAGTTTTGGAGTCTTTTAAAGTATTAGAGTAACTTTTTTACAAATATATATT
ATTATTTTTTGAGCAATTTTTAAATGGGTCATAAAGGAAGAAAGAAGTTAAGATTAAAGC
TTTGTGTAAAAACATGATGGATAGACCTATTGTAATAAATTTTAGTTAGATTAAATAATA
TTTTGCATATAATTTATTTATTTATTACAGTAAAAAGCAATAGAAGAAGAAAAGAAAAGA
TTCATTCCTATTGAGAAAAAACTAGACACAAATCACACAATAATAAAAGTTTCTGTTTAT
AACAGCATCAATGGATTAAAGCAAAACGAATATTTAGTATACGATATTTAATTTTTGTAA
GATTTAGTTTTTAAAATTGAATGTCTTTCAGAAAAACTCTCTGAAAGAATTCCGAGTGGA
CAACAATCCCAGCCTGACTCAAAGTTTATGTAGCTTTATTCAATAACTTTTTTTCAATTT
ATATAAATTTCTCTAAAATTTTCATATGAAATTAATGAATAATTTTAAAACTATTTAGGA
AACCCTCATTCTTATTTATAGAAAATACTTTTTACAACAACCAATACAAGATAGATGTTA
AAAACCTATACCAGTAAATCATTTTTTCTAATTAAAAATTTAATTTATTATATACATTTT
TTTAAAGTGAATGGCAGCAAGAAGCAAAAATAAACTCTCAAAATAGTGGAATGCAGTTTG
AAGAAGAATTTGAAGAAAAAACCTTAAATGAAATGTTTGAGTAAATTAAAATACAAATAG
GTAAGCCATATGTATTTAGACATTAAAATAAATGTGATCACATGATTGTTTTTAATGAAA
TACGTCTATGGAATACAGATCTGCCAGCTGATAAAGATCTGTACCCCTTCAATGTTTTTC
TGCCTAAAGTAAAAAGAAGAAAATGTGATGGATGCAACTTATTCTTTACAGAGTATTTTT
TTTTTTTTTGAAAACTTTTTTTATTTACCATTCTAAATTTAATCAAAATAGGATCGTTTG
CTTCAATGATAAAGTTTCATCTAAAAATCCTATTTTTCTATGTGAAAAGTGTTTTAATCA
AACCCATATCAAGTAAATTTAATTAATAAACAATATTAAAATCTAATCTTTTTTTTAAGT
TGGAAAAAAGAATTAAGATATAACGATTTCTCATATTATCCATACATTTATGAATGA