Identifiers and Description

Gene Model Identifier

TTHERM_00316860

Standard Name

None

Aliases

PreTt20986 | 31.m00288 | 3687.m00090

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00628 ) PHD-finger
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF00130 ) Phorbol esters/diacylglycerol binding domain (C1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00316860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig9803.0.g460.000000000040005666873964816PHD-zinc-finger like domain
Tetrahymena borealisEI9_05554.20.0000000029989608248573072PHD-finger family protein (100
3 aa)
DictyBaseDDB_G02838590.000000019990673443141236DDB_G0283859 on chromosome: 4
position 1066871 to 1072160
SGDYPR031W0.000019995566179747357NTO1 Subunit of the NuA3 histo
ne acetyltransferase complex t
hat acetylates histone H3; con
tains PHD finger domain that i
nteracts with methylated histo
ne H3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316860(coding)
ATGATTGATAGAAACTAAAATAAATCTTAGAAAAAGAGTAAGGATAAATATATGATGGAT
CAGATTAAAATTAAGGAAATCAAATCTTCACTTAAAAATATGATTAGCTAAGGAATGTAC
CCTTAAATCTTTTCGGACAGTAAGGATTAGAGATGTAATAGTTGCTTTAGTGATTAGGAG
TATAAGAATAACAAGTTGTTGCAATGTGATTTCTGTTAATTTCTAACACACGACAAATGT
CTATCTTCTTAAAGAATTCATTCTATTATTTAGAATTTATGGTTTTGTGATAGGTGTCTA
TATATTATTGGGAATGATTTTAACAAGCCTAACTTATTAGACTTTCCTATAATTAGTTGT
TCTGATTGCAATAAATTTCATGGAATCATGATTAACTCAAAAAATGGAGTTTGGACACAT
GAATTCTGTTTAAAATAAAATAGAGATGATATCAGCTAATTTTCTTCTGGTCATTCAATA
ACTCAGAATTTAATTTAAGAGAGAGATGATTTTTTTTAAAATGATGAGAGCACCCAGAAT
TTTTGCTAATATTGTAGATAAAAAGAAGGAAAAATGTCATTATGCAGTATGCCAGGTTGT
TCCAAGTAATTTCATCTTTTTTGTTTGATAAATGAAAATCCTAATCAAATTGAGTAAGCT
CCTCTTTCAAAACAGAAGTATTACTGCAATGAGCATTATAGACAAGAATTGATGATTACT
AACTTCGCTTTACAATAAAAATAAGACACTTAGCATAGCTCTGATAAGAATATTGAGATC
AAGTAGTTTACAGATGATCAGCAACTGCGAAACGAAGGATAAAATTAAATTTTTGCAAAT
TAGCTCAGTAAAAATGGAATTTAGAAATACAAATTATAGCTTCGCTACCACTTTGATATG
ATTAATTACTTTTACTAAAATCTCTCATAGCTTTCATAGTTTGAACATTAAAATTACAAG
CAGCCATATTCAAATTCAAATATTAATGTGGAAGCAGACAAAAATTCTGTAAATCAAGAT
AAAAATTGTCAATTAAAAATTTGCAATTGGGAATTTTGCTTTATTACAAGTTTGCCTGAA
TTTTATCAGAACGAAAAATAATTTTTAGAATGCCTTGCAAATTACTTTATCAGGATAAGG
TCATACAACCCTATATCTAAAAGTGTCGTATTATTTGAAAGCTACTATTCTCATAGTTAG
CTGCTATACTTCATTCGTAAAAATTTTAATCACCCTAATGATCTACTATATCCAGAAAAC
AATATGGCCTATTTTATAGATATGATTAAACTTAATGTAAATCGGTTTATTAAGGAGCTT
ATAAGCAATAAAATAATTCAAAAAGTTAAAAGAGAAAATTGA


>TTHERM_00316860(protein)
MIDRNQNKSQKKSKDKYMMDQIKIKEIKSSLKNMISQGMYPQIFSDSKDQRCNSCFSDQE
YKNNKLLQCDFCQFLTHDKCLSSQRIHSIIQNLWFCDRCLYIIGNDFNKPNLLDFPIISC
SDCNKFHGIMINSKNGVWTHEFCLKQNRDDISQFSSGHSITQNLIQERDDFFQNDESTQN
FCQYCRQKEGKMSLCSMPGCSKQFHLFCLINENPNQIEQAPLSKQKYYCNEHYRQELMIT
NFALQQKQDTQHSSDKNIEIKQFTDDQQLRNEGQNQIFANQLSKNGIQKYKLQLRYHFDM
INYFYQNLSQLSQFEHQNYKQPYSNSNINVEADKNSVNQDKNCQLKICNWEFCFITSLPE
FYQNEKQFLECLANYFIRIRSYNPISKSVVLFESYYSHSQLLYFIRKNFNHPNDLLYPEN
NMAYFIDMIKLNVNRFIKELISNKIIQKVKREN


>TTHERM_00316860(gene)
AATTAATTTTAAAATTGCTTTTCTAAAATTAAAAAAGTTATATACTAATAAAAGAATTAC
TTCTAAGCGAAATATTTGGAAATGATTGATAGAAACTAAAATAAATCTTAGAAAAAGAGT
AAGGATAAATATATGATGGATCAGATTAAAATTAAGGAAATCAAATCTTCACTTAAAAAT
ATGATTAGCTAAGGAATGTACCCTTAAATCTTTTCGGTAGTGAAATTGCTTTATATAAAA
AATTAAATTCCTAATATATAGTTATTAAATAATAGGACAGTAAGGATTAGAGATGTAATA
GTTGCTTTAGTGATTAGGAGTATAAGAATAACAAGTTGTTGCAATGTGATTTCTGTTAAT
TTCTAACACACGACAAATGTCTATCTTCTTAAAGAATTCATTCTATTATTTAGAATTGTA
AAAGAATATCAAAATAATTTAAATTTTATTTTTCTCATATATTATCAAACCATTTTTAAT
ATTATTTAAAACTTAGTATGGTTTTGTGATAGGTGTCTATATATTATTGGGAATGATTTT
AACAAGCCTAACTTATTAGACTTTCCTATAATTAGTTGTTCTGATTGCAATAAATTTCAT
GGAATCATGATTAACTCAAAAAATGGAGTTTGGGTATAAAAATTTTTAATTAAAATTTAT
AAAAATCAAGTTATTTTATTTTAGACACATGAATTCTGTTTAAAATAAAATAGAGATGAT
ATCAGCTAATTTTCTTCTGGTCATTCGTAATATATTTTTGATCCGATTCTAATAACAAAT
TAATTTTGTTTTTAAAACTATAAACTATGTAGAATAACTCAGAATTTAATTTAAGAGAGA
GATGATTTTTTTTAAAATGATGAGAGCACCCAGAATTTTTGCTAATATTGTAGATAAAAA
GAAGGAAAAATGTCATTATGCAGTATGCCAGGTTGTTCCAAGTAATTTCATCTTTTTTGT
TTGATAAATGAAAATCCTAATCAAATTGAGTAAGCTCCTCTTTCAAAACAGAAGTAATTT
TCAATCTTTCTAATAGTCAAATTAATATTAATAATAATTCCTTAAATAAAGGTATTACTG
CAATGAGCATTATAGACAAGGTATATATATATTAATAAAATAGAAAAAATGATTGATTGA
TTGATTCTCTTTTACTTTTTTAATTATTTAGAATTGATGATTACTAACTTCGCTTTACAA
TAAAAATAAGAGTAACAAAATTAATTATTTACTTTTGAGTATTTTTATTTTTTAATTTTA
CTCAATTAATAATTTTAAGCACTTAGCATAGCTCTGATAAGAATATTGAGATCAAGTAGT
TTACAGATGATCAGCAACTGCGAAACGAAGGATAAAATTAAATTTTTGCAAATTAGCTCA
GTAAAAATGGAATTTAGAAATACAAATTATAGCTTCGCTACCACTTTGATATGATTAATT
ACTTTTACTAAAATCTCTCATAGCTTTCATAGTTTGAACATTAAAATTACAAGCAGCCAT
ATTCAAATTCAAATATTAATGTGGAAGCAGACAAAAATTCTGTAAATCAAGATAAAAATT
GTCAATTAAAAATTTGCAATTGGGAATTTTGCTTTATTACAAGTTTGCCTGAATTTTATC
AGAACGAAAAATAATTTTTAGAATGCCTTGCAAATTACTTTATCAGGATAAGGTCATACA
ACCCTATATCTAAAAGTGTCGTATTATTTGAAAGCTACTATTCTCATAGTTAGCTGCTAT
ACTTCATTCGTAAAAATTTTAATCACCCTAATGATCTACTATATCCAGAAAACAATATGG
CCTATTTTATAGATATGATTAAACTTAATGTAAATCGGTTTATTAAGGAGCTTATAAGCA
ATAAAATAATTCAAAAAGTTAAAAGAGAAAATTGA