Identifiers and Description

Gene Model Identifier

TTHERM_00316360

Standard Name

None

Aliases

PreTt20947 | 31.m00249 | 3687.m00051

Description

GTP1/OBG family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00316360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08447.19.997093137033517e-262GTP1/OBG family protein (406 a
a)
OxytrichaContig21926.0.g92.9998475177091926e-17750S ribosome-binding GTPase
WormBaseWBGene000153463.0010290635211535e-164Uncharacterized GTP-binding pr
otein C02F5.3 status:Confirm
ed UniProt:P34280 protein_
id:CCD62627.1
DictyBaseDDB_G02794511.0000297864968827e-159drg2 on chromosome: 3 position
2066556 to 2067929
SGDYGR173W6.998828886836733e-138RBG2 Protein with a role in tr
anslation; forms a complex wit
h Gir2p; has similarity to mam
malian developmentally regulat
ed GTP-binding protein
Stentor CoeruleusSteCoe_297941.4788975056432133e-74

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316360(coding)
ATGGGTGTTTTAGAAAAGATAAAGGAAATAGAAGAAGAAATGGCCAGAACCCAAAAGAAT
AAGGCCACAGAATATCACTTGGGTTTATTAAAAGCAAAATTAGCAAAATATCGTACTTAG
TTATTAGAACCAGCTTCCAAGGGTCCTAAGGGTGAAGGTTTCGAAGTTTAGAAATTTGGT
AATGCTAGAGTATGTATGATTGGTTTCCCTTCCGTCGGTAAATCTACATTATTGAGTTCT
ATCACTGAAACTGAAAGTTTAGCTGCTGCTTATGAATTCACTACTTTGACTTGTATTCCT
GGTGTAATTAATTATAATGATACAAAGATATAACTTTTGGATCTTCCTGGTATCATCGAA
GGTGCCGCTGATGGTAGAGGTAGAGGTAGATAAGTTATTGCTGTCGCTAAAGCTTCTGAT
TTAGTTCTCATGGTCTTAGACGCTTAAAAAAGTGAGGAACACAAAGCCAAACTCACATAT
GAATTAGAAAAAGTAGGTATTCGTCTCAATCAAGAAAGGCCTGATATAACAGTAACTATA
AATAAAACTGGTGGTGTAAAGCTTATATCCACTTGTTAATTGACAAGAATCGATGAAAAG
CAAGTCAAAAATATTTTTTCAGAATATAAAATTCACAATGCAACAATTTTGTGTAGACAA
GATGTCACAATTGATGATATTATTGATTCAATTGAAGGCAATCGTAAATATGTTCGTTGT
CTTTATGTTTATAATAAGATTGATACCATCTCAATTGAAGAAGTAGATATGATAGCCCGT
CAACCTAATAATGTCGTTATTTCTTGTCATCAAAAGCTTAACTTTGACTATCTCCTTGAA
AAAATTTGGGAAAATCTTGGATTAGTCAGAATCTACACTAAAAGAAAAGGTTAACCTCCT
GATTTGGGTGATCCTTTAATTTTAACTCACGGAAGAAATGGTTGCACAATCAAATCAGCA
GTTGAACAAATTCACAGAGATTTGATTAAAGATTTTGCTCATGCAACTGTTTGGGGTAGA
AGTGCTAAATTTATGCCTTAGAAGGTTGGTTTAAATCATATATTATGTGATGAAGATGTC
ATTTAAATCTATAAGAAGGCTAAGACTTCCACAAAAGCTAAAGAATCTAATAAATTAGTA
AGTGTAACAGAAAAGAAAGATGTTAAAAAAGAAGCAAAGGACATGAAAGACCAGAAAGCT
AAGGATAAGAAAAAATGA


>TTHERM_00316360(protein)
MGVLEKIKEIEEEMARTQKNKATEYHLGLLKAKLAKYRTQLLEPASKGPKGEGFEVQKFG
NARVCMIGFPSVGKSTLLSSITETESLAAAYEFTTLTCIPGVINYNDTKIQLLDLPGIIE
GAADGRGRGRQVIAVAKASDLVLMVLDAQKSEEHKAKLTYELEKVGIRLNQERPDITVTI
NKTGGVKLISTCQLTRIDEKQVKNIFSEYKIHNATILCRQDVTIDDIIDSIEGNRKYVRC
LYVYNKIDTISIEEVDMIARQPNNVVISCHQKLNFDYLLEKIWENLGLVRIYTKRKGQPP
DLGDPLILTHGRNGCTIKSAVEQIHRDLIKDFAHATVWGRSAKFMPQKVGLNHILCDEDV
IQIYKKAKTSTKAKESNKLVSVTEKKDVKKEAKDMKDQKAKDKKK


>TTHERM_00316360(gene)
ATGGGTGTTTTAGAAAAGATAAAGGAAATAGAAGAAGAAATGGCCAGAACCCAAAAGAAT
AAGGCCACAGAATATCACTTGGGTTTATTAAAAGCAAAATTAGCAAAATATCGTACTTAG
TTATTAGAACCAGCTTCCAAGGGTCCTAAGGGTGAAGGTTTCGAAGTTTAGAAATTTGGT
AATGCTAGAGTATGTATGATTGGTTTCCCTTCCGTCGGTAAATCTACATTATTGAGTTCT
ATCACTGAAACTGAAAGTTTAGCTGCTGCTTATGAATTCACTACTTTGACTTGTATTCCT
GGTGTAATTAATTATAATGATACAAAGATATAACTTTTGGATCTTCCTGGTATCATCGAA
GGTGCCGCTGATGGTAGAGGTAGAGGTAGATAAGTTATTGCTGTCGCTAAAGCTTCTGAT
TTAGTTCTCATGGTCTTAGACGCTTAAAAAAGTGAGGAACACAAAGCCAAACTCACATAT
GAATTAGAAAAAGTAGGTATTCGTCTCAATCAAGAAAGGCCTGATATAACAGTAACTATA
AATAAAACTGGTGGTGTAAAGCTTATATCCACTTGTTAATTGACAAGAATCGATGAAAAG
CAAGTCAAAAATATTTTTTCAGAATATAAAATTCACAATGCAACAATTTTGTGTAGACAA
GATGTCACAATTGATGATATTATTGATTCAATTGAAGGCAATCGTAAATATGTTCGTTGT
CTTTATGTTTATAATAAGATTGATACCATCTCAATTGAAGAAGTAGATATGATAGCCCGT
CAACCTAATAATGTCGTTATTTCTTGTCATCAAAAGCTTAACTTTGACTATCTCCTTGAA
AAAATTTGGGAAAATCTTGGATTAGTCAGAATCTACACTAAAAGAAAAGGTAATTTGTTA
AATCATTAGTTAACGTATAGACAATCAAGTGCAAAAAAATCACATAAATATTAGGTTTGA
TTATGTTAAATCTTATTTAGAATTAACCAAAATAATACTTATTGTTGAACATAAAATGTT
TGTTTAAATTTTTATAAATTATTCATAATATTAAATAGGTTAACCTCCTGATTTGGGTGA
TCCTTTAATTTTAACTCACGGAAGAAATGGTTGCACAATCAAATCAGCAGTTGAACAAAT
TCACAGAGATTTGATTAAAGATTTTGCTCATGCAACTGTTTGGGGTAGAAGTGCTAAATT
TATGCCTTAGAAGGTTGGTTTAAATCATATATTATGTGATGAAGATGTCATTTAAATCTA
TAAGAAGGCTAAGACTTCCACAAAAGCTAAAGAATCTAATAAATTAGTAAGTGTAACAGA
AAAGAAAGATGTTAAAAAAGAAGCAAAGGACATGAAAGACCAGAAAGCTAAGGATAAGAA
AAAATGA