Identifiers and Description

Gene Model Identifier

TTHERM_00316190

Standard Name

None

Aliases

PreTt20930 | 31.m00232 | 3687.m00034

Description

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07620 ) SLEI
  • ( PF04548 ) AIG1 family
  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( TIGR01612 ) rhoptry protein
  • ( PF07661 ) MORN repeat variant
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00158 ) ribosomal protein L9
  • ( PF07693 ) KAP family P-loop domain
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF02881 ) SRP54-type protein, helical bundle domain
  • ( PF02263 ) Guanylate-binding protein, N-terminal domain
  • ( PF08432 ) Fungal protein of unknown function
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( PF04297 ) Putative helix-turn-helix protein, YlxM /

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00316190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08475.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (2766 aa)
DictyBaseDDB_G02918105.0019039340728934e-39DDB_G0291810 on chromosome: 6
position 784328 to 786502

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316190(coding)
ATGGGTTGTGTTTGTGCAAAACCAAAACCACAAAGCAATAAAAGCATAAAAAAAGAGGAG
AATCAGGGCATAAAAGCAAATAGGTCCGATTCACCAAGTTAAGAAAAGAATAATGCAAAG
GAAGAGTTGCATACAAATAAAGAAGAAACTTAGATGGATCTTTTATAAAAGAAAGAAATT
TATATAGATGAGTACGAGGAAGAAGAAGTAAATAGGTACGAAGAATTTGAATAAAAAGAT
AGAGCACTTTTAGCTAAATACTCATAAGTTATGGATAGAGGCAAAAAGGTTAAACTTGAG
ATTGAAAATCAAAAAGAAAAGCCAAAACTCAATTAAGGCTCAGAGAAGAGATTCAAAGAG
CTTTTGAATTTAACTTAGATGATTGAATCTAATTTAGAATAATCAGAGCTCATTCAAGGT
AAAGATATTGTGATAGTCCTAGGTGCTACAGGAGTAGGAAAATCTACTACTATTAACTAC
TTGCTCGGAAAGAAGATGATTTGGTCTAAGATTTAAAACTAAACAAAAAGCTATGTTTAT
GAAGTAGAAGGAATTACTGTGGCTAAAGGAGAGCAAGAGGCTGCTAAAATAGGAACTAAA
CCAATGGAATCTTAAACTAAAACTATTAACGTTTACAATGTTTAGCATCCAAAAGATGAA
AGAGAGCTTGTACTTTGTGATACTCCAGGTCTTTTAGACTCTTAGGGATCCATAGTAGAT
ATAGCAAACCAAGTTGGAATAGTAAAATCTTTATAGTATGCCAAATCTATTAGAGTTTTG
TTGCTTATCGGATACAAGAATCTTGTTTCTGTTGAAGGCAAGGGTAAGCTCATAAAAGAA
GTTATTGATTTATATAGCAAGCTAATTAAGGACTATGAAGAGTCTTAAGAAAGCGTGTTG
ATTGGTTTCACCCATTTAAATAGCGATACTACTCTTTAGCAGATCAATAATTCTTTAAAA
GCAATGACTGATTCTGTAAGCGATGATGATAAGGTTTCCCAATTTCTTCATATATCAATA
CAAAGCATAGAAAAGAAAAACAAACTCTTTACACTTATAAAGCCACTAATAAGCGATAAG
AGATAGAATTTAATCGACTCTCTTTTTAACATATAAGAAATTCCTTAGGAAAGAGTTAAT
TAGTATTTTACATATGCTCTTGCATAAAATACAAAAAACGAATTTGAACTTATCCTTCAA
AGTTATTAAAAAGATATTTCAAATTTATTTTAGAGGGAAGAATATGATCAAATTACTAAC
AGATTAAGTGTTCTCAAAAAACTAAACGAGCAATTGGAATTTACAATTGTCAAGAAATGT
TATGCTGAAAGCGTGCAAGCAGTGATCAATCTAGACTTAGTCAAGTAGACTTAATCACTT
TTGCAGAGAATAACTTCCTTATAGCAAGAAATGGTGCAAATCCTTTTATAAAATATTGTT
AAAGTTTCTAATTATCTGTGCTGGACAGATTAAATTAGACACGAATACTAAGAAATAAAT
GATTGCATAATTTCTTATAATGATTTTATAGACATTCTTTCTAGCGCGCTAGAGGAATGC
CTTTAATCTATTGAAAAAACAGAAAATTACAAAGTTACAATTTAAGATTTGTTAAAGCTT
TATTATGTTTACTACTGTAGTGAAATAGAAGATACATTCAAGGCCAATGCTAAGACACTC
CGTATTTTCCATAAAGGTTAGGTTAAAATAAAGAGTATTTACACAAATAACTTTTATACT
GCTGCTTGCTTTTCTATAAGCAAAAGAGTTATAACTCTCTTGGAATAGATGGATGAGTTA
GTTAAATCTAATGAAGAAGTCAATGTTAACGATTTAGAATCAAACTTATCTAAGCTTAAA
GATTTGCATGAATAATAAGTAGGAGATCACCTCTAGTTAAATTCTTAGCTGATTTATCAA
GAGCAAGTAAAAAAATGGTGTGATTTCATTTAGCAAAAGAAGACAGTTTTTGAAATAGAT
TATAACAAATACGATTAAGTGTTAAAAAATATAGATCAAATGAAGATAGCTTATCACTTT
TTAGCTTAAATTAGCGGATCATAGAGACTAATGAATGATCATTTCCCATAATTTAAAACA
GCTTAAAAAGACACTACACAAAAATTAGTATAGCAAGCAATCATGCTTTTTAATAAAGCA
ATTACTCAAAAAAAACTAGGACATATGGAAAAACCAATTTAATGTGCCATGGAAATAATG
AATATTAGCGACGATATAAGAAATAAATTGCAAGAAGCCTCTCAAGCACTCTTTGTTCAT
TTAGGATCAATTGTTTAAAAGTTCGACATGAAATTCAGCAGCTGCTCTTCATAGATAAAA
AATTGTTTGATCCCAAAATACGAAACAGCTAATAAGGACTTATTTAAAAGCACAACAGAA
GATGAATTCTAAATTGTGAAGAAAAAAATTAATTCAATCCAAAAAATCTTTAAAAAGATC
ACTATGAAGTATTACTAATCATTCAAATTCTTTTAGAACTCAGTGACAAAGAGCAAAATC
GCATTGGAGATTTTTATTGAAGAAGTTATGAAGTTCACACAAGACCAAGTTAATGAATTC
AGAAATCCTACAGGAATTTTAAATGGCTTATTCACTTTAAAGCAGTCTTCTATACTCTTA
AAAGACTACACTAATAAAAAATTTGACGAAATAGCATTTTAGGAAATGATTTCTCTTATT
TGCAACAATATAAACACAAAATTTTCTTTAATAACTAAAATGGTAAACAGCATTCAAATC
CCTAATAACATTGATGATACTTACAGAAATATTGAGGAACAAATCAAGAATATCAGCCAT
TTACTCTAATTCATTTAAAACCTTTCAAATTATATTTTAAATTTTGAAGATAAAAATCAA
AACACAATTGAGTCTCTTATTCAAATGGTTACTAATTGCTAGAATGGATTTGCTTAATAA
TTATTCAACAAGCTTAAATCTAATATGTATGATTTCGAACATTAAAAGCTACCATCTGAT
GCTATGAGATAAAAGATCATTCTCGATTAACTATAAAAACTTAAAGAATACAATTACAGC
TATTCTCTACTTAAAGTTGATCTATACGAACATGTCTTAGAAAAATCTATTTCTGAGTAA
TCTAGACTTATTAAGGAAATCAGTGACTATTTGTCAGACAATCCATCTTTACCTGATGAT
TTTAATTAAGAAAGTGCTTAGAAAAATCTTACTTTGATTAGATAAGCCGGAGTACTTTAT
CTAACCCATTTCATTGGAAGACTAGATAATCCTGCTGATACTCTTCAAAGTGAATTGACT
ATGAAATAAAAAGGATTGGATAAAAAAGTCAAAAGCATGGTTAAGCAATCTGATTATGAC
CAAATATTAGAGTACATGAGAACCATGAGTGAGGATAACGAATCTTATAAATCAATAAAG
AAGATTTTAAAGGAGAAGGTTAATATGCTCTTCGATTAAATAATTAAATCCTTCACCAAA
AGAAATATTTTGGATGACATTTATATTAATAAAATTAAACAAGACATAAGAAATTTAGAA
TAATCTAAATAGAAGCTGTCACAAATTAAATTCAAAAATTTTAGCATTGAAAAATTCTTC
CCTCAAATAACTCATCACTTGACTGCCTTTTTATAGAAATAAGTAAAGAGATTTGAAGAA
AAAATAGCTACTTAAAAAGTAGAGAAGGCCAGCCGTTGCTTGATGGTTGTTTGTAGAGTT
GTGTAGAATTTTTAGAGCTATATTAGACCCGAGGATAACTAACTACCTGATAAAATGATC
AACCAAATGAAGCTCTGTCTGCGCTAAATAGAAAACTAAATTGACATTAAAAACAAACAA
CAAACAACTTCCATTCTCCAAGTTCTTTAGGTACTAGTACAGAACTAACACCAATACAAG
GATGAATATAATTTAATCTTATAAAAAGTGAATAAATAAATTTTGGAACAAGCAGCAGTG
TTCGTAAACACAAAGATAGATTCATAAAACGAAGAAATAAGCGTCCAAGCTATAGCTGAA
ACTCTTAAGGGTGAATATTAGTATTTACTTATGTACACTTTAGATAACTATAACTAGCAT
TATCTAGCTTTCTTCTAGCCCATATTGAAGAGAATTTAAGATGAAATGTTAGATGTGAGA
AATATGTTTACTCAACGTAAGATTACAAACATCCTCAATTTAATTAATGGATCTAAAAGT
TCAATAGTTTAAAAAGAGGTCTGTAATTAATACAATAATCTCTGTGATACTTTCTTTGAT
TTACTCCAAAATAGAAATTATAATGGCACTTAAGAACTTCTCAAATTCCTCTCATAAATT
GCTGACGGTATTCGTTCTTTCTCCTACAACTCCTTGAAACAGAAATATTTTGAATTGTAA
GTTTGCATAGAGTAAGAATTTAATAGGTTACAAACTTCAACTGTACAAAGTCTAAACTAA
ATTGTTTTTGAGAGAGAATCTGAAGGAATTTATGATGTTGTTTAATTTTATTAATTCAAC
TCCTTAATGGCTTAATTTAACTTTTAATATGTCAAACATGAATAATTCAATACATAATCT
TGCCAAGTCTTCGATAAAATATAAAAATAATTAAAACAGTCTGTATCTCTTTTGCAGCAC
ACTGTCTTTAACAATACAGTAAAACTAATTGATTTCATTGAATAGACAAGGGTAAGTTTG
AATGATTAACAAATTAATGTAATCTAAATCTACAAGAAATATTTATCTGATATGCAATCA
ACTCATTCACATGTTAGCAGCTTCAACGATCTCAATAAATTAGTGAATGATGGATGCTGG
ACTATCTAATAAGTTATATCTGATTTACTTAATGCAAAGAAAAATGAAATTGTTAATGGA
ATCAATTCGTTACTTATACAAAAAAATTACAAGGAAACTTCAAGAATTTTAAGGTAAGTA
GAGGAGTTCTCAAAGAAAATTTAAGAGAGCTCTGTTAATATGAACACTTCAGACATCATG
AAGGTAGTATTTAGAAAATACGAAGAGAAAGCAATAGAAGCTCAAAGAAGATCAAAGGAT
AAGTATGATTCTAAGCTATTTGCATTGATAGAAGATTTATCTGAAATAGAAAAATATTTT
AAGGAAATCATAGTTCAAATCTCCAACTATAATGCATCAGAAGAAATAATCAACTAAATT
AAATTATCTATAGCCCAATTAACTAAACAAATTTATTCCTAAAATTTCGAGGATGAATCA
GACGTGAGAGAGTTTGTTGCATCTATTATTAATATCAGATAAATAGCATTCGAAATAGGA
CAAGTCCATGAATTCACTCTTGAATAAATAAGTGAGCTTATCACAACTAAATTTTAATAA
TTTACACCTCAATTCATTTCAGATGTTTCATCTAAGTTGAGATAAGATAAACTTGGTTTA
TTGATAATCTAGGAAAATAGTAAAAACTTCGAAGGTCTTCTTAACAAGATGATTGAGGAA
CTTTCCAAGAATTAATTCAGCTTGGAATATGTAAACAATAATATTAAAGGTGAAAAATTC
ATTGCAAGTGAGTTTTCAATCCAATATAAATATTATGAAGAGTGCTGGAAAAACCTCCTA
AGCAAGTGGCACTAAGGAGATCTCAAAGCAGAAACTATTTTATAAAAGACAAAGTCTTTG
TTTAAAAAATTCTGCTCATCCTACTAAGTCGATTACTTGAATCAAAAGTAAATCACTTGG
TCAGCATCATAGAAGTAAGATCTTTCTATCATGCTAGCTCACTTGAGTACTTTCTGGTCT
ATAGTAAACTGCCAAAGAAGAGAAGACAGTTTCAGAAAATTGCATCCTGTTTAAGTTTCA
ACTGTAATGAGATTGCTCTCAATAGATACAACAACTACTTAGATGCCTATTGAAAACCAT
CTAGTTTAGGTAAAGACAGGTGAAGGTAAATCTATCATTTTGGGAATTACTTCTTGCTTC
TTAGGCTTACTAGGATTCTATGTAGATTGCTGCTGCTACAGTAATTATCTAAGTTAGCGT
GATTTTTAGAGCTTCAGTCATATTTTCTAGCAATTAGAAATTGATAATGTAATTAAATAT
AACACTTTTGAGAAATAATTCGAAGATATAATTAATGATCCAGAAGATATGAGATAAGTC
GGTTTAGATTTACTTGATAATAAGTTACATAAAAAGGTACAGATATAAAGATAAGGGTCT
TTGGGCAGTTAACCAAAGAGAAGAATTCTTCTTATTGATGAAGTAGATTTCTTTTTCGGT
GAAGATTTCATTGGTCGTACTTACCCTGTTGCACTCTATTACAATAATCAAGATGTTATT
GATATTTTGAAATATATCTGGTAGAATAGAGCTGTTCATATCGATAAGTTTAAGTAAACA
CAAGTATATAAAAAGCTATTTTAGAACAATCCAAATTTAGTTCCTTGGTAAGCATTTATT
GATGAACGTATAAAAATGATGTACGAAGATGTAAATAATCTTGAAGGCCACAGATATTTG
ACATATACTCCTTCTGGAAAAAGCAAAACAATTATTTGCTATAAATCTCTTGATGGCATT
TCCTTCAATACAGTCAAAGGATACAAAACAGCTTTTGCTTATATCTAAGAGTGGGAAAAG
AAGAATATAACAGAAGATGTTATGAATGAAAACCTTTCATTTATAATTAATGTAGGCTGC
TTCTCATTCGCTTAGATACCTTAGGAATATCAACTGGTATTGGGAGTCAGTGGTACTTTA
GAAGATATGAGTGATTATCAGAAAAATTTAACTAGAAATCTCTTCAACATAAGAAAATTA
ACAATCTCCCCATCAATTTATGGGTAGTCTAAATTTTCTTTTAAAAAAGAAAAGGACGTA
GTTGTAAAAGAGAATAAGTTCCTTTATCATTTAGAAATATAATCTCAAATAGAAAACGTT
ATGAAGTAAAATAGATCAGTAATAGTATTCTTTGAGTCGAAGAGGGCATTAGACATTTTT
AAAAATGAGTTTAAAACATAATACGATTATTAAGTTCTTTCTGAAGAAACTAATTTCAAA
GGACACACAATAGTTAAAGCAGGTTCTATGAGCATGATAACACTCGCAACAAAGCCTTTT
GGTAGAGGCTGTGATTATATCAGCACAGATCCTGAGCTGGATAAGAATGGTGGTATTCAT
ATTATCTAAACCTTCCTCTCTGAAGATCTAGCAGAAGAGACTCAAATAAAAGGTAGAACT
GCAAGACAAGCTTAATGTGGTAGCTACAGTTTAGTAGTCAACAGAGAAGATCTTGTACTA
AACTTTAATCTAAATGCTAGTGTTAAAAATTTCTCTTATGAATTCTTACACCAATTGAGA
TAAACCACCTAAAAAAACAAAGAAAAATCTTTATCAATAAAGCTTGAAGAAACAAGCTAA
TCTCACAAGGAATCTATGCGTCTAAAGCAAATTTTGCTAAATTATTCTCCTAATAACAAT
GAAGAAATACAAGAAATATTAATCAAATTTAACAGGGTCACAGACAGAACTGAGAATAAA
ACAAATATGTATAATTTCTATAGTGATTTAGCAGGTAAAATTGGTATCTATGAAAATAAT
TTCGAGTACGACGAGTATAACAATCCTAAAAATGTTGGTTTGGGTAGTGACAATTCATAT
AATGATCTATCACTATTGATAGGTCTATTTTATCCAGAAGAAGGACTAGATGAAGACATT
AATCATTTATTAATACCAACATTAAGAAAGAAGGGTTTCAAAGTTTGTGAAGTCGTTGTT
ACTGAGCAGGAATTTATCGTAAAGCTACCTTAATTCGATTAAGCTTGGGTTATAAGTGGA
TATAAGTTCCACTCTCATAGAATGGAAAGCAGATTCTAAGATGCTATAGAATATCACTTG
AAACAACAAAAGGGTTTGATGATTTGGGCTGATAATAATCCTTATATTGTGCATGCAAAT
CTGATACTTTAAAGAATTCCAGTTGGTTATTATAATAGATAACCTATCTTTATTAAATTA
GATGGTTCTGATTATGGTGATTAGGTCTTAAAGGCTGGTGATTACTTTGAAACTTAATAG
TTCGGTCCACATTTAATTACTACTGGTATCAATAATCTCCACGAGGGTATTACTATCTGC
TATCCTTAAGTACTGAGCAATACACCAAAAGATAACTTTGGCCATCTTAATATTATCGGA
TTAAGCAGTGCTTCCAAGCCATGTTTCTTTGTGCTCTCCGGAACAGAGGATAGAGGTAGA
ATTGTATTTGATTGTGGTTTTACAAAACTAATGAGAGATTAATGGAACACTGCTGGTACA
GTTACCTATGTAACTAATTGTTATGCTTGGCTATATTGGAAGGAAAGATTCGTATAAAAT
TTATGA


>TTHERM_00316190(protein)
MGCVCAKPKPQSNKSIKKEENQGIKANRSDSPSQEKNNAKEELHTNKEETQMDLLQKKEI
YIDEYEEEEVNRYEEFEQKDRALLAKYSQVMDRGKKVKLEIENQKEKPKLNQGSEKRFKE
LLNLTQMIESNLEQSELIQGKDIVIVLGATGVGKSTTINYLLGKKMIWSKIQNQTKSYVY
EVEGITVAKGEQEAAKIGTKPMESQTKTINVYNVQHPKDERELVLCDTPGLLDSQGSIVD
IANQVGIVKSLQYAKSIRVLLLIGYKNLVSVEGKGKLIKEVIDLYSKLIKDYEESQESVL
IGFTHLNSDTTLQQINNSLKAMTDSVSDDDKVSQFLHISIQSIEKKNKLFTLIKPLISDK
RQNLIDSLFNIQEIPQERVNQYFTYALAQNTKNEFELILQSYQKDISNLFQREEYDQITN
RLSVLKKLNEQLEFTIVKKCYAESVQAVINLDLVKQTQSLLQRITSLQQEMVQILLQNIV
KVSNYLCWTDQIRHEYQEINDCIISYNDFIDILSSALEECLQSIEKTENYKVTIQDLLKL
YYVYYCSEIEDTFKANAKTLRIFHKGQVKIKSIYTNNFYTAACFSISKRVITLLEQMDEL
VKSNEEVNVNDLESNLSKLKDLHEQQVGDHLQLNSQLIYQEQVKKWCDFIQQKKTVFEID
YNKYDQVLKNIDQMKIAYHFLAQISGSQRLMNDHFPQFKTAQKDTTQKLVQQAIMLFNKA
ITQKKLGHMEKPIQCAMEIMNISDDIRNKLQEASQALFVHLGSIVQKFDMKFSSCSSQIK
NCLIPKYETANKDLFKSTTEDEFQIVKKKINSIQKIFKKITMKYYQSFKFFQNSVTKSKI
ALEIFIEEVMKFTQDQVNEFRNPTGILNGLFTLKQSSILLKDYTNKKFDEIAFQEMISLI
CNNINTKFSLITKMVNSIQIPNNIDDTYRNIEEQIKNISHLLQFIQNLSNYILNFEDKNQ
NTIESLIQMVTNCQNGFAQQLFNKLKSNMYDFEHQKLPSDAMRQKIILDQLQKLKEYNYS
YSLLKVDLYEHVLEKSISEQSRLIKEISDYLSDNPSLPDDFNQESAQKNLTLIRQAGVLY
LTHFIGRLDNPADTLQSELTMKQKGLDKKVKSMVKQSDYDQILEYMRTMSEDNESYKSIK
KILKEKVNMLFDQIIKSFTKRNILDDIYINKIKQDIRNLEQSKQKLSQIKFKNFSIEKFF
PQITHHLTAFLQKQVKRFEEKIATQKVEKASRCLMVVCRVVQNFQSYIRPEDNQLPDKMI
NQMKLCLRQIENQIDIKNKQQTTSILQVLQVLVQNQHQYKDEYNLILQKVNKQILEQAAV
FVNTKIDSQNEEISVQAIAETLKGEYQYLLMYTLDNYNQHYLAFFQPILKRIQDEMLDVR
NMFTQRKITNILNLINGSKSSIVQKEVCNQYNNLCDTFFDLLQNRNYNGTQELLKFLSQI
ADGIRSFSYNSLKQKYFELQVCIEQEFNRLQTSTVQSLNQIVFERESEGIYDVVQFYQFN
SLMAQFNFQYVKHEQFNTQSCQVFDKIQKQLKQSVSLLQHTVFNNTVKLIDFIEQTRVSL
NDQQINVIQIYKKYLSDMQSTHSHVSSFNDLNKLVNDGCWTIQQVISDLLNAKKNEIVNG
INSLLIQKNYKETSRILRQVEEFSKKIQESSVNMNTSDIMKVVFRKYEEKAIEAQRRSKD
KYDSKLFALIEDLSEIEKYFKEIIVQISNYNASEEIINQIKLSIAQLTKQIYSQNFEDES
DVREFVASIINIRQIAFEIGQVHEFTLEQISELITTKFQQFTPQFISDVSSKLRQDKLGL
LIIQENSKNFEGLLNKMIEELSKNQFSLEYVNNNIKGEKFIASEFSIQYKYYEECWKNLL
SKWHQGDLKAETILQKTKSLFKKFCSSYQVDYLNQKQITWSASQKQDLSIMLAHLSTFWS
IVNCQRREDSFRKLHPVQVSTVMRLLSIDTTTTQMPIENHLVQVKTGEGKSIILGITSCF
LGLLGFYVDCCCYSNYLSQRDFQSFSHIFQQLEIDNVIKYNTFEKQFEDIINDPEDMRQV
GLDLLDNKLHKKVQIQRQGSLGSQPKRRILLIDEVDFFFGEDFIGRTYPVALYYNNQDVI
DILKYIWQNRAVHIDKFKQTQVYKKLFQNNPNLVPWQAFIDERIKMMYEDVNNLEGHRYL
TYTPSGKSKTIICYKSLDGISFNTVKGYKTAFAYIQEWEKKNITEDVMNENLSFIINVGC
FSFAQIPQEYQLVLGVSGTLEDMSDYQKNLTRNLFNIRKLTISPSIYGQSKFSFKKEKDV
VVKENKFLYHLEIQSQIENVMKQNRSVIVFFESKRALDIFKNEFKTQYDYQVLSEETNFK
GHTIVKAGSMSMITLATKPFGRGCDYISTDPELDKNGGIHIIQTFLSEDLAEETQIKGRT
ARQAQCGSYSLVVNREDLVLNFNLNASVKNFSYEFLHQLRQTTQKNKEKSLSIKLEETSQ
SHKESMRLKQILLNYSPNNNEEIQEILIKFNRVTDRTENKTNMYNFYSDLAGKIGIYENN
FEYDEYNNPKNVGLGSDNSYNDLSLLIGLFYPEEGLDEDINHLLIPTLRKKGFKVCEVVV
TEQEFIVKLPQFDQAWVISGYKFHSHRMESRFQDAIEYHLKQQKGLMIWADNNPYIVHAN
LILQRIPVGYYNRQPIFIKLDGSDYGDQVLKAGDYFETQQFGPHLITTGINNLHEGITIC
YPQVLSNTPKDNFGHLNIIGLSSASKPCFFVLSGTEDRGRIVFDCGFTKLMRDQWNTAGT
VTYVTNCYAWLYWKERFVQNL


>TTHERM_00316190(gene)
ATGGGTTGTGTTTGTGCAAAACCAAAACCACAAAGCAATAAAAGCATAAAAAAAGAGGAG
AATCAGGGTAATATCCATTAAACTTAATAGCTTTAATTCTAATGAATAATTTAATTGAAT
TGAGTAGGCATAAAAGCAAATAGGTCCGATTCACCAAGTTAAGAAAAGAATAATGCAAAG
GAAGAGTTGCATACAAATAAAGAAGAAACTTAGATGGATCTTTTATAAAAGAAAGAAATT
TATATAGATGAGTACGAGGAAGAAGAAGTAAATAGGTACGAAGAATTTGAATAAAAAGAT
AGAGCACTTTTAGCTAAATACTCATAAGTTATGGATAGAGGCAAAAAGGTTAAACTTGAG
ATTGAAAATCAAAAAGAAAAGCCAAAACTCAATTAAGGCTCAGAGAAGAGATTCAAAGAG
CTTTTGAATTTAACTTAGATGATTGAATCTAATTTAGAATAATCAGAGCTCATTCAAGGT
AAAGATATTGTGATAGTCCTAGGTGCTACAGGAGTAGGAAAATCTACTACTATTAACTAC
TTGCTCGGAAAGAAGATGATTTGGTCTAAGATTTAAAACTAAACAAAAAGCTATGTTTAT
GAAGTAGAAGGAATTACTGTGGCTAAAGGAGAGCAAGAGGCTGCTAAAATAGGAACTAAA
CCAATGGAATCTTAAACTAAAACTATTAACGTTTACAATGTTTAGCATCCAAAAGATGAA
AGAGAGCTTGTACTTTGTGATACTCCAGGTCTTTTAGACTCTTAGGGATCCATAGTAGAT
ATAGCAAACCAAGTTGGAATAGTAAAATCTTTATAGTATGCCAAATCTATTAGAGTTTTG
TTGCTTATCGGATACAAGAATCTTGTTTCTGTTGAAGGCAAGGGTAAGCTCATAAAAGAA
GTTATTGATTTATATAGCAAGCTAATTAAGGACTATGAAGAGTCTTAAGAAAGCGTGTTG
ATTGGTTTCACCCATTTAAATAGCGATACTACTCTTTAGCAGATCAATAATTCTTTAAAA
GCAATGACTGATTCTGTAAGCGATGATGATAAGGTTTCCCAATTTCTTCATATATCAATA
CAAAGCATAGAAAAGAAAAACAAACTCTTTACACTTATAAAGCCACTAATAAGCGATAAG
AGATAGAATTTAATCGACTCTCTTTTTAACATATAAGAAATTCCTTAGGAAAGAGTTAAT
TAGTATTTTACATATGCTCTTGCATAAAATACAAAAAACGAATTTGAACTTATCCTTCAA
AGTTATTAAAAAGATATTTCAAATTTATTTTAGAGGGAAGAATATGATCAAATTACTAAC
AGATTAAGTGTTCTCAAAAAACTAAACGAGCAATTGGAATTTACAATTGTCAAGAAATGT
TATGCTGAAAGCGTGCAAGCAGTGATCAATCTAGACTTAGTCAAGTAGACTTAATCACTT
TTGCAGAGAATAACTTCCTTATAGCAAGAAATGGTGCAAATCCTTTTATAAAATATTGTT
AAAGTTTCTAATTATCTGTGCTGGACAGATTAAATTAGACACGAATACTAAGAAATAAAT
GATTGCATAATTTCTTATAATGATTTTATAGACATTCTTTCTAGCGCGCTAGAGGAATGC
CTTTAATCTATTGAAAAAACAGAAAATTACAAAGTTACAATTTAAGATTTGTTAAAGCTT
TATTATGTTTACTACTGTAGTGAAATAGAAGATACATTCAAGGCCAATGCTAAGACACTC
CGTATTTTCCATAAAGGTTAGGTTAAAATAAAGAGTATTTACACAAATAACTTTTATACT
GCTGCTTGCTTTTCTATAAGCAAAAGAGTTATAACTCTCTTGGAATAGATGGATGAGTTA
GTTAAATCTAATGAAGAAGTCAATGTTAACGATTTAGAATCAAACTTATCTAAGCTTAAA
GATTTGCATGAATAATAAGTAGGAGATCACCTCTAGTTAAATTCTTAGCTGATTTATCAA
GAGCAAGTAAAAAAATGGTGTGATTTCATTTAGCAAAAGAAGACAGTTTTTGAAATAGAT
TATAACAAATACGATTAAGTGTTAAAAAATATAGATCAAATGAAGATAGCTTATCACTTT
TTAGCTTAAATTAGCGGATCATAGAGACTAATGAATGATCATTTCCCATAATTTAAAACA
GCTTAAAAAGACACTACACAAAAATTAGTATAGCAAGCAATCATGCTTTTTAATAAAGCA
ATTACTCAAAAAAAACTAGGACATATGGAAAAACCAATTTAATGTGCCATGGAAATAATG
AATATTAGCGACGATATAAGAAATAAATTGCAAGAAGCCTCTCAAGCACTCTTTGTTCAT
TTAGGATCAATTGTTTAAAAGTTCGACATGAAATTCAGCAGCTGCTCTTCATAGATAAAA
AATTGTTTGATCCCAAAATACGAAACAGCTAATAAGGACTTATTTAAAAGCACAACAGAA
GATGAATTCTAAATTGTGAAGAAAAAAATTAATTCAATCCAAAAAATCTTTAAAAAGATC
ACTATGAAGTATTACTAATCATTCAAATTCTTTTAGAACTCAGTGACAAAGAGCAAAATC
GCATTGGAGATTTTTATTGAAGAAGTTATGAAGTTCACACAAGACCAAGTTAATGAATTC
AGAAATCCTACAGGAATTTTAAATGGCTTATTCACTTTAAAGCAGTCTTCTATACTCTTA
AAAGACTACACTAATAAAAAATTTGACGAAATAGCATTTTAGGAAATGATTTCTCTTATT
TGCAACAATATAAACACAAAATTTTCTTTAATAACTAAAATGGTAAACAGCATTCAAATC
CCTAATAACATTGATGATACTTACAGAAATATTGAGGAACAAATCAAGAATATCAGCCAT
TTACTCTAATTCATTTAAAACCTTTCAAATTATATTTTAAATTTTGAAGATAAAAATCAA
AACACAATTGAGTCTCTTATTCAAATGGTTACTAATTGCTAGAATGGATTTGCTTAATAA
TTATTCAACAAGCTTAAATCTAATATGTATGATTTCGAACATTAAAAGCTACCATCTGAT
GCTATGAGATAAAAGATCATTCTCGATTAACTATAAAAACTTAAAGAATACAATTACAGC
TATTCTCTACTTAAAGTTGATCTATACGAACATGTCTTAGAAAAATCTATTTCTGAGTAA
TCTAGACTTATTAAGGAAATCAGTGACTATTTGTCAGACAATCCATCTTTACCTGATGAT
TTTAATTAAGAAAGTGCTTAGAAAAATCTTACTTTGATTAGATAAGCCGGAGTACTTTAT
CTAACCCATTTCATTGGAAGACTAGATAATCCTGCTGATACTCTTCAAAGTGAATTGACT
ATGAAATAAAAAGGATTGGATAAAAAAGTCAAAAGCATGGTTAAGCAATCTGATTATGAC
CAAATATTAGAGTACATGAGAACCATGAGTGAGGATAACGAATCTTATAAATCAATAAAG
AAGATTTTAAAGGAGAAGGTTAATATGCTCTTCGATTAAATAATTAAATCCTTCACCAAA
AGAAATATTTTGGATGACATTTATATTAATAAAATTAAACAAGACATAAGAAATTTAGAA
TAATCTAAATAGAAGCTGTCACAAATTAAATTCAAAAATTTTAGCATTGAAAAATTCTTC
CCTCAAATAACTCATCACTTGACTGCCTTTTTATAGAAATAAGTAAAGAGATTTGAAGAA
AAAATAGCTACTTAAAAAGTAGAGAAGGCCAGCCGTTGCTTGATGGTTGTTTGTAGAGTT
GTGTAGAATTTTTAGAGCTATATTAGACCCGAGGATAACTAACTACCTGATAAAATGATC
AACCAAATGAAGCTCTGTCTGCGCTAAATAGAAAACTAAATTGACATTAAAAACAAACAA
CAAACAACTTCCATTCTCCAAGTTCTTTAGGTACTAGTACAGAACTAACACCAATACAAG
GATGAATATAATTTAATCTTATAAAAAGTGAATAAATAAATTTTGGAACAAGCAGCAGTG
TTCGTAAACACAAAGATAGATTCATAAAACGAAGAAATAAGCGTCCAAGCTATAGCTGAA
ACTCTTAAGGGTGAATATTAGTATTTACTTATGTACACTTTAGATAACTATAACTAGCAT
TATCTAGCTTTCTTCTAGCCCATATTGAAGAGAATTTAAGATGAAATGTTAGATGTGAGA
AATATGTTTACTCAACGTAAGATTACAAACATCCTCAATTTAATTAATGGATCTAAAAGT
TCAATAGTTTAAAAAGAGGTCTGTAATTAATACAATAATCTCTGTGATACTTTCTTTGAT
TTACTCCAAAATAGAAATTATAATGGCACTTAAGAACTTCTCAAATTCCTCTCATAAATT
GCTGACGGTATTCGTTCTTTCTCCTACAACTCCTTGAAACAGAAATATTTTGAATTGTAA
GTTTGCATAGAGTAAGAATTTAATAGGTTACAAACTTCAACTGTACAAAGTCTAAACTAA
ATTGTTTTTGAGAGAGAATCTGAAGGAATTTATGATGTTGTTTAATTTTATTAATTCAAC
TCCTTAATGGCTTAATTTAACTTTTAATATGTCAAACATGAATAATTCAATACATAATCT
TGCCAAGTCTTCGATAAAATATAAAAATAATTAAAACAGTCTGTATCTCTTTTGCAGCAC
ACTGTCTTTAACAATACAGTAAAACTAATTGATTTCATTGAATAGACAAGGGTAAGTTTG
AATGATTAACAAATTAATGTAATCTAAATCTACAAGAAATATTTATCTGATATGCAATCA
ACTCATTCACATGTTAGCAGCTTCAACGATCTCAATAAATTAGTGAATGATGGATGCTGG
ACTATCTAATAAGTTATATCTGATTTACTTAATGCAAAGAAAAATGAAATTGTTAATGGA
ATCAATTCGTTACTTATACAAAAAAATTACAAGGAAACTTCAAGAATTTTAAGGTAAGTA
GAGGAGTTCTCAAAGAAAATTTAAGAGAGCTCTGTTAATATGAACACTTCAGACATCATG
AAGGTAGTATTTAGAAAATACGAAGAGAAAGCAATAGAAGCTCAAAGAAGATCAAAGGAT
AAGTATGATTCTAAGCTATTTGCATTGATAGAAGATTTATCTGAAATAGAAAAATATTTT
AAGGAAATCATAGTTCAAATCTCCAACTATAATGCATCAGAAGAAATAATCAACTAAATT
AAATTATCTATAGCCCAATTAACTAAACAAATTTATTCCTAAAATTTCGAGGATGAATCA
GACGTGAGAGAGTTTGTTGCATCTATTATTAATATCAGATAAATAGCATTCGAAATAGGA
CAAGTCCATGAATTCACTCTTGAATAAATAAGTGAGCTTATCACAACTAAATTTTAATAA
TTTACACCTCAATTCATTTCAGATGTTTCATCTAAGTTGAGATAAGATAAACTTGGTTTA
TTGATAATCTAGGAAAATAGTAAAAACTTCGAAGGTCTTCTTAACAAGATGATTGAGGAA
CTTTCCAAGAATTAATTCAGCTTGGAATATGTAAACAATAATATTAAAGGTGAAAAATTC
ATTGCAAGTGAGTTTTCAATCCAATATAAATATTATGAAGAGTGCTGGAAAAACCTCCTA
AGCAAGTGGCACTAAGGAGATCTCAAAGCAGAAACTATTTTATAAAAGACAAAGTCTTTG
TTTAAAAAATTCTGCTCATCCTACTAAGTCGATTACTTGAATCAAAAGTAAATCACTTGG
TCAGCATCATAGAAGTAAGATCTTTCTATCATGCTAGCTCACTTGAGTACTTTCTGGTCT
ATAGTAAACTGCCAAAGAAGAGAAGACAGTTTCAGAAAATTGCATCCTGTAAATAAATAT
TAAATTAAATAAAATTTTTAACAACATTTACTTTAATTAATTAAGTTTCTGTTGATTTTA
ATCTAATTCCATTTTCATTAATTTAAAGGTTTAAGTTTCAACTGTAATGAGATTGCTCTC
AATAGATACAACAACTACTTAGATGCCTATTGAAAACCATCTAGTTTAGGTAAAGACAGG
TGAAGGTAAATCTATCATTTTGGGAATTACTTCTTGCTTCTTAGGCTTACTAGGATTCTA
TGTAGATTGCTGCTGCTACAGTAATTATCTAAGTTAGCGTGATTTTTAGAGCTTCAGTCA
TATTTTCTAGCAATTAGAAATTGATAATGTAATTAAATATAACACTTTTGAGAAATAATT
CGAAGATATAATTAATGATCCAGAAGATATGAGATAAGTCGGTTTAGATTTACTTGATAA
TAAGTTACATAAAAAGGTACAGATATAAAGATAAGGGTCTTTGGGCAGTTAACCAAAGAG
AAGAATTCTTCTTATTGATGAAGTAGATTTCTTTTTCGGTGAAGATTTCATTGGTCGTAC
TTACCCTGTTGCACTCTATTACAATAATCAAGATGTTATTGATATTTTGAAATATATCTG
GTAGAATAGAGCTGTTCATATCGATAAGTTTAAGTAAACACAAGTATATAAAAAGCTATT
TTAGAACAATCCAAATTTAGTTCCTTGGTAAGCATTTATTGATGAACGTATAAAAATGAT
GTACGAAGATGTAAATAATCTTGAAGGCCACAGATATTTGACATATACTCCTTCTGGAAA
AAGCAAAACAATTATTTGCTATAAATCTCTTGATGGCATTTCCTTCAATACAGTCAAAGG
ATACAAAACAGCTTTTGCTTATATCTAAGAGTGGGAAAAGAAGAATATAACAGAAGATGT
TATGAATGAAAACCTTTCATTTATAATTAATGTAGGCTGCTTCTCATTCGCTTAGATACC
TTAGGAATATCAACTGGTATTGGGAGTCAGTGGTACTTTAGAAGATATGAGTGATTATCA
GAAAAATTTAACTAGAAATCTCTTCAACATAAGAAAATTAACAATCTCCCCATCAATTTA
TGGGTAGTCTAAATTTTCTTTTAAAAAAGAAAAGGACGTAGTTGTAAAAGAGAATAAGTT
CCTTTATCATTTAGAAATATAATCTCAAATAGAAAACGTTATGAAGTAAAATAGATCAGT
AATAGTATTCTTTGAGTCGAAGAGGGCATTAGACATTTTTAAAAATGAGTTTAAAACATA
ATACGATTATTAAGTTCTTTCTGAAGAAACTAATTTCAAAGGACACACAATAGTTAAAGC
AGGTTCTATGAGCATGATAACACTCGCAACAAAGCCTTTTGGTAGAGGCTGTGATTATAT
CAGCACAGATCCTGAGCTGGATAAGAATGGTGGTATTCATATTATCTAAACCTTCCTCTC
TGAAGATCTAGCAGAAGAGACTCAAATAAAAGGTAGAACTGCAAGACAAGCTTAATGTGG
TAGCTACAGTTTAGTAGTCAACAGAGAAGATCTTGTACTAAACTTTAATCTAAATGCTAG
TGTTAAAAATTTCTCTTATGAATTCTTACACCAATTGAGATAAACCACCTAAAAAAACAA
AGAAAAATCTTTATCAATAAAGCTTGAAGAAACAAGCTAATCTCACAAGGAATCTATGCG
TCTAAAGCAAATTTTGCTAAATTATTCTCCTAATAACAATGAAGAAATACAAGAAATATT
AATCAAATTTAACAGGGTCACAGACAGAACTGAGAATAAAACAAATATGTATAATTTCTA
TAGTGATTTAGCAGGTAAAATTGGTATCTATGAAAATAATTTCGAGTACGACGAGTATAA
CAATCCTAAAAATGTTGGTTTGGGTAGTGACAATTCATATAATGATCTATCACTATTGAT
AGGTCTATTTTATCCAGAAGAAGGACTAGATGAAGACATTAATCATTTATTAATACCAAC
ATTAAGAAAGAAGGGTTTCAAAGTTTGTGAAGTCGTTGTTACTGAGCAGGAATTTATCGT
AAAGCTACCTTAATTCGATTAAGCTTGGGTTATAAGTGGATATAAGTTCCACTCTCATAG
AATGGAAAGCAGATTCTAAGATGCTATAGAATATCACTTGAAACAACAAAAGGGTTTGAT
GATTTGGGCTGATAATAATCCTTATATTGTGCATGCAAATCTGATACTTTAAAGAATTCC
AGTTGGTTATTATAATAGATAACCTATCTTTATTAAATTAGATGGTTCTGATTATGGTGA
TTAGGTCTTAAAGGCTGGTGATTACTTTGAAACTTAATAGTTCGGTCCACATTTAATTAC
TACTGGTATCAATAATCTCCACGAGGGTATTACTATCTGCTATCCTTAAGTACTGAGCAA
TACACCAAAAGATAACTTTGGCCATCTTAATATTATCGGATTAAGCAGTGCTTCCAAGCC
ATGTTTCTTTGTGCTCTCCGGAACAGAGGATAGAGGTAGAATTGTATTTGATTGTGGTTT
TACAAAACTAATGAGAGATTAATGGAACACTGCTGGTACAGTTACCTATGTAACTAATTG
TTATGCTTGGCTATATTGGAAGGAAAGATTCGTATAAAATTTATGA