Identifiers and Description

Gene Model Identifier

TTHERM_00316189

Standard Name

None

Aliases

3687.m01153

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00636 ) RNase3 domain
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR02191 ) ribonuclease III
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF07708 ) Tash protein PEST motif
  • ( PF00035 ) Double-stranded RNA binding motif
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00094 ) conserved hypothetical protein TIGR00094
  • ( TIGR00288 ) conserved hypothetical protein TIGR00288

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00316189

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08476.19.997093137033517e-262hypothetical protein (1949 aa)
WormBaseWBGene000009391.999598840915195e-17locus:dcr-1 Endoribonuclease
dcr-1 status:Partially_conf
irmed UniProt:P34529 prote
in_id:CCD71200.2
OxytrichaContig17740.0.g1100.0000000000000030004923591262316Ribonuclease III domain
DictyBaseDDB_G02809630.000000000003001226732525078rrpC on chromosome: 3 position
3986737 to 3993698
SGDYIR002C0.000000000006001570085597868MPH1 Member of the DEAH family
of helicases, functions in an
error-free DNA damage bypass
pathway that involves homologo
us recombination, binds to fla
p DNA and stimulates activity
of Rad27p and Dna2p; mutations
confer a mutator phenotype

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316189(protein)
MKNLKKALAKKHEEQSLKNSQQDSVIFAKNTENFLKSDSSSSDQDEEFEEKQLPVIKKQY
GFNGIPNSYAFKINDESSDEDDEEIFKDQVSPKINEQGKNTIYEIRNYQKELFKNSYSKN
SIIYLETGAGKTMIATMLINYFFQKQKKAPQKKKIIFLANTVQLVKQQYAEIKNNLQRIS
EMMENDKEISQILKFQEGINYRRIFEKENHIVKCHGSYKQKDNLQIETFTKQKWDYLLEN
YEIFVMIGQVLLNGLRRGYIRIEDIEVIIYDECHHTRQDHPYCLIQYEFYHFHKRRNEQV
QLPKIYGLTASPVLDIEVKSDSNIMKKKISELCTNLDANFVKYNIEESKKYIKEATICVE
EYGEEKNIQERANQFLQEQIIGEKWISDIEDKQNEEMRYTEILNFYIKFQQFKNSYFSNL
SPMNKQILLDIEKIICLYSMQVDAQLGKYSVSLFLKDVNDELQKLGQFQHNNEEMQELKK
LFKAQTEKFIESVDKSEKNISKKFMFLYNKLKQTMIHDKEEFECYKVKNKYYEQEFHQHE
KITKVQKYIKDNQSMILVFVEEKIIIKYLQKLLQIWMDDEDRDKDEDEIIFRYKKIVCLT
GQSNFQDRKKKNLNKNQYQNSEFTQNDNFEFAEEEYRQQQMKQESLISSQINKEEDIDSL
KEKINDHQKSAQRCVLVNLDFEVSKQSENIEAFRKKELQIILSTSVTEEGFDIPSCNLVI
SFNKISNLKSFVQIKGRARKENSKFIIMAKDKYQKQDYETDIESYKDLIQQIKEIAPKVE
KQEIEIRPNYKYKIVKETGAILNTNWSVNLFHTYANQLLYSYDSNIKGPFYYYIEITNVG
FICQIIVPSQSGLKTFCSNPQAQKEDAKKDACFQAVIILYRQYKIFDQYLRNISQKIQNS
QSEKSESLFEDEKDEKLTKILQKYCKSYVDVKQKCKMYYFQSVMGECFKQSFFKSILDIQ
QQKSYTFQLYLIKFNDQGKKLPSSGFIKNQDSELGIIHSTQIPIKDTIKYYLQMHENEVY
ANMIYQQEIQISQQQYDKLMLINRFLNSVALNKDIEFYAEYTGEVVNGKGKLFKDHGKNA
SKNLQYKFDNSEGFSALLTVIRPSNNNTNLYEINFDHIEILEKYINYMSGVYKVRNKTKL
NEEEKAARFQSRKLKQDDPFADYKVKPYYDCVNFFDCTKQLDPNIYQDSRKKLVLQSIMS
GRHLNRFIFYGCKSYEEIQKEYQQVPTGKDPFKQIKQLKAQVELEEVSFTSNENHMVLQV
QLFTKHLRSQTNLYLKRVGVLTENFKGDYKYSPHQFTIFPLNVSLLMKLNILHKTFLYQI
RDTFGVHHFQQIRLPKFFDKAYQRIKNNNKTSCSYNLDQIEQPHFLVENYQGVLDVMSKS
EKYNQFCKKYNNHQLMEGYNQISIRKFDQKYIKHNPIFESYQVYKKNIFELQISELMKSL
TSLEYAVNNKESSLERYEFLGDTVLKCLSSTQIYFEHPKSMEDHLHVHRTIIIQNRNLAQ
IAVKKKIFKYILSSKIETLSPIGIKYEIAVDDDEQNQFQKEKEPDEYDKADQRNKNKKGN
EEDGDAENEEIEEQQQQNDIPNLLRLEPTYRHIKGKTLADTLESIIGVFFQQKKDLNLCQ
YLLFSLQVLNKPDLTFNHSYDRSLQQSQLQNPIYVQLKEIESILGYTFQNINLLFQAFTL
PSIESLCIQIPSLKNTNLNKLHQINNAIQKKENQGTFEKIDQISKENQNKIYQKDSNEWE
NLKNYNLCNQRLEFLGDAVLDLIIVEYLFNKFPNSDPGELTQMKTSLVQNKTLCLINLMK
GFYKFIIGSIQHNKEEIELLLNNVEMFMGDTSLMYDTTYNQSLIKTLGDVIESLVGAIFI
DNNLDYEITKKIVMETLFAEILQYFTGQEHRLKNLQLYIEKVLKKEFGKVSLIEDETDIK
EGKKRFFIQSEDNNKEVSFEVYAYDQIDAIDQIYIEINQKKRQKK


>TTHERM_00316189(coding)
ATGAAAAACCTAAAAAAAGCATTAGCCAAAAAGCACGAAGAATAAAGCTTGAAAAACAGT
CAATAAGATTCTGTTATTTTTGCTAAAAATACAGAAAACTTCTTAAAGAGTGACTCAAGC
AGTAGTGACTAAGATGAAGAATTTGAAGAAAAACAACTTCCTGTTATCAAGAAATAATAT
GGATTTAATGGAATACCAAATAGTTATGCTTTCAAAATAAACGATGAGTCAAGCGATGAA
GATGATGAAGAAATTTTTAAAGATTAGGTATCTCCTAAAATAAATGAACAAGGCAAAAAT
ACGATTTACGAAATTAGAAACTATTAAAAGGAGTTGTTTAAAAATTCTTATAGCAAAAAT
AGTATCATTTATCTTGAAACAGGTGCTGGAAAGACTATGATTGCCACAATGCTTATAAAT
TACTTTTTCTAAAAACAAAAAAAGGCTCCATAAAAAAAGAAAATTATTTTTTTAGCCAAC
ACTGTATAGCTTGTAAAACAATAGTACGCAGAAATAAAGAATAATTTACAAAGAATTTCA
GAGATGATGGAAAACGATAAAGAAATCAGCTAGATATTAAAATTTTAAGAAGGCATTAAT
TACAGAAGAATATTTGAAAAAGAAAATCATATTGTGAAGTGTCATGGTAGTTATAAGCAA
AAGGATAATTTATAAATAGAAACTTTTACTAAATAAAAATGGGACTACTTACTTGAAAAT
TATGAAATATTCGTTATGATTGGTTAGGTATTGTTAAATGGTTTACGTAGAGGATACATT
CGCATTGAAGATATTGAGGTTATTATTTATGATGAATGTCACCATACGAGATAAGATCAT
CCTTATTGCTTAATATAATATGAGTTCTATCACTTTCACAAAAGACGTAACGAATAGGTT
TAATTGCCAAAGATTTATGGATTAACTGCCTCTCCAGTTTTGGATATAGAAGTAAAATCT
GATTCAAATATCATGAAGAAAAAAATCTCAGAACTCTGCACAAATTTAGATGCAAATTTT
GTAAAGTATAATATCGAGGAATCTAAAAAATATATCAAAGAAGCTACAATTTGTGTTGAA
GAATATGGTGAAGAAAAGAATATTTAAGAAAGAGCAAATTAGTTCTTATAAGAATAAATT
ATTGGAGAGAAGTGGATTTCTGACATAGAAGATAAACAGAATGAGGAAATGAGATACACT
GAGATTTTAAATTTCTATATTAAATTTTAATAATTTAAGAACTCATATTTTAGCAATTTA
AGTCCAATGAATAAGTAGATATTGCTAGATATAGAAAAAATTATCTGCTTATATAGCATG
CAAGTTGATGCTCAGTTAGGAAAATATTCTGTCAGTTTATTTTTGAAAGATGTTAATGAT
GAACTATAAAAACTTGGCCAATTTTAGCACAATAATGAAGAAATGTAGGAATTAAAAAAA
CTATTCAAAGCTTAAACAGAAAAATTTATAGAATCAGTAGATAAAAGTGAAAAAAATATT
TCTAAAAAATTCATGTTTTTGTATAATAAATTAAAATAAACAATGATACATGATAAAGAA
GAATTTGAGTGCTATAAAGTCAAAAATAAATACTACGAATAAGAATTTCACTAACATGAG
AAAATAACTAAAGTGTAAAAATACATTAAGGATAATTAATCGATGATTTTAGTTTTTGTT
GAAGAAAAAATTATCATTAAATACTTGCAGAAGCTTCTTTAAATTTGGATGGATGATGAA
GATAGAGATAAAGATGAAGATGAAATTATTTTTAGATATAAAAAAATTGTTTGCTTAACA
GGCTAATCAAACTTCTAGGATCGAAAGAAGAAAAATTTAAATAAAAATTAATATTAAAAC
TCTGAATTCACATAAAATGATAATTTTGAATTTGCTGAAGAAGAGTATAGGCAGTAGCAA
ATGAAATAGGAAAGCTTAATCAGCAGTTAAATAAACAAAGAAGAGGATATAGACTCCTTG
AAAGAAAAAATTAATGATCACTAAAAATCTGCTTAAAGATGTGTTCTTGTTAATCTTGAT
TTTGAAGTCAGCAAATAATCTGAAAACATTGAGGCATTCAGAAAAAAAGAGTTGTAAATA
ATTCTCTCAACTAGTGTAACTGAAGAAGGTTTCGATATACCTTCCTGTAATTTGGTTATT
TCGTTTAATAAAATATCTAACTTGAAGTCGTTCGTTCAAATTAAAGGAAGAGCGAGGAAA
GAAAATTCGAAGTTTATAATCATGGCAAAGGACAAATATCAAAAATAAGATTATGAAACA
GATATTGAATCTTACAAAGATTTAATTTAATAAATTAAGGAAATAGCTCCAAAAGTTGAG
AAATAAGAAATTGAAATCAGACCTAATTATAAATATAAGATTGTCAAAGAAACTGGGGCT
ATTTTAAATACAAATTGGTCTGTAAATCTGTTTCATACTTATGCTAACTAGCTTCTTTAT
AGCTATGATTCGAATATCAAGGGACCTTTTTACTATTATATTGAGATTACAAATGTTGGC
TTTATTTGCTAAATAATTGTTCCCTCCTAATCTGGATTAAAAACATTTTGCAGCAATCCT
TAGGCTTAAAAAGAGGATGCAAAAAAAGATGCATGCTTTTAGGCTGTTATCATTCTTTAC
AGATAATATAAAATTTTTGACTAGTATCTGAGAAACATATCTTAGAAGATACAAAATTCA
TAAAGTGAAAAATCAGAATCTTTATTTGAAGACGAAAAAGATGAAAAACTCACTAAAATA
CTATAAAAATATTGTAAATCTTATGTAGATGTAAAACAAAAATGTAAAATGTACTACTTT
TAGTCTGTTATGGGAGAGTGCTTTAAATAAAGTTTTTTTAAATCTATTTTAGATATTTAG
TAATAAAAAAGTTATACATTTTAATTGTACTTGATAAAGTTCAATGATTAAGGGAAGAAA
CTCCCTTCTTCTGGTTTTATAAAAAACTAAGATTCTGAATTAGGTATCATACACAGCACT
TAAATTCCTATAAAAGATACAATTAAATACTATCTTTAAATGCATGAAAATGAAGTTTAT
GCGAATATGATATATTAGTAAGAAATTTAGATAAGTCAATAATAATATGACAAGCTAATG
TTGATTAATAGATTTTTAAATTCTGTTGCCCTAAATAAAGATATTGAGTTCTATGCAGAA
TATACAGGAGAAGTTGTAAATGGCAAAGGGAAATTATTTAAAGATCATGGTAAAAATGCT
AGCAAGAACTTATAATATAAATTTGATAACTCAGAAGGATTCAGTGCACTACTCACTGTT
ATTAGGCCATCCAATAACAATACAAATCTTTATGAAATCAATTTTGATCATATTGAAATA
TTAGAAAAGTACATTAATTACATGAGTGGAGTTTATAAAGTTAGAAACAAGACTAAACTA
AATGAAGAAGAGAAAGCAGCTAGGTTTTAAAGTAGAAAATTAAAATAAGATGATCCATTT
GCTGATTATAAAGTCAAACCTTATTATGACTGTGTAAACTTTTTTGATTGTACTAAGTAG
CTAGATCCAAATATTTATTAAGATTCAAGAAAAAAATTGGTGTTACAAAGCATCATGTCT
GGAAGACATCTTAATCGTTTTATATTTTATGGGTGCAAAAGCTATGAAGAAATCTAAAAG
GAGTATTAATAGGTTCCCACGGGAAAAGATCCTTTTAAGTAAATAAAATAGTTAAAGGCT
TAAGTTGAGTTGGAGGAAGTCTCATTTACTTCAAATGAGAATCATATGGTATTATAGGTT
TAGCTTTTTACTAAGCATTTGAGAAGTTAAACCAACTTATATCTTAAAAGAGTTGGCGTC
CTGACAGAAAATTTTAAGGGTGATTATAAATATTCCCCTCACTAGTTCACTATATTTCCT
TTAAATGTTAGTCTTCTTATGAAACTTAATATTTTGCATAAAACATTCCTTTACTAAATC
AGAGACACATTTGGAGTGCATCACTTTTAATAAATCCGTCTTCCTAAATTTTTTGATAAG
GCTTATTAGAGAATCAAAAATAATAATAAAACGAGTTGCTCCTATAACCTTGATTAAATT
GAATAACCTCACTTTTTAGTAGAAAATTATTAAGGAGTTTTAGATGTTATGAGCAAAAGT
GAAAAATATAATTAATTTTGTAAGAAGTACAATAACCACCAACTAATGGAGGGATACAAT
CAGATAAGCATTAGAAAATTTGATTAAAAATATATAAAACATAATCCTATATTTGAATCA
TATTAAGTATATAAGAAAAACATCTTTGAATTGTAGATTAGCGAGTTAATGAAGTCTTTG
ACCTCTCTAGAATATGCTGTTAACAATAAGGAATCATCACTAGAAAGATATGAATTTCTT
GGTGATACAGTTTTGAAATGTTTATCTAGTACACAAATCTATTTTGAACACCCTAAAAGC
ATGGAAGATCATCTCCATGTTCATAGAACTATAATTATACAGAATAGAAACTTGGCATAA
ATTGCTGTAAAAAAGAAAATATTTAAATATATTTTATCTTCTAAGATTGAAACGCTTTCT
CCCATAGGAATAAAATATGAAATAGCAGTAGACGATGATGAATAAAATTAATTCTAGAAA
GAAAAGGAGCCAGATGAGTACGATAAAGCTGACTAAAGGAATAAAAATAAGAAAGGCAAT
GAAGAAGATGGAGATGCAGAAAATGAAGAAATTGAAGAATAATAATAATAAAATGACATT
CCTAATTTATTGCGTTTAGAACCAACATATCGCCACATTAAAGGAAAAACTTTAGCTGAT
ACTTTGGAAAGTATAATCGGTGTATTTTTTTAACAGAAAAAGGATTTAAATCTTTGCTAA
TATCTTTTGTTCTCATTGTAAGTTCTCAATAAGCCAGATTTAACTTTTAACCATAGCTAT
GATAGAAGCCTGCAGTAAAGTTAGCTGTAAAACCCTATTTATGTCCAATTGAAGGAGATA
GAAAGTATTTTAGGCTATACATTTTAAAATATAAACCTCCTATTTTAAGCCTTCACACTT
CCAAGCATTGAAAGTCTTTGTATTTAAATCCCCAGTTTAAAAAATACAAACTTAAATAAA
TTGCATCAAATAAATAATGCTATTTAAAAAAAAGAAAATTAAGGAACATTTGAAAAAATT
GATTAAATTAGCAAAGAAAATCAAAATAAAATTTACTAAAAAGATTCTAATGAATGGGAA
AATTTGAAAAATTATAATCTGTGCAATCAAAGATTAGAATTTTTAGGAGATGCAGTCCTT
GATTTAATTATCGTCGAGTATTTATTCAACAAATTTCCTAACTCTGATCCTGGTGAGTTG
ACATAAATGAAAACTTCATTGGTACAAAACAAAACCCTCTGTTTAATCAACTTAATGAAG
GGATTTTATAAATTTATCATTGGAAGCATTTAACATAATAAAGAAGAAATAGAATTATTG
CTCAATAATGTTGAAATGTTTATGGGAGATACTTCTTTAATGTACGATACAACTTATAAT
TAATCATTAATTAAGACATTAGGTGACGTAATTGAAAGTTTAGTTGGAGCGATATTTATT
GATAATAATTTAGACTATGAAATTACCAAAAAAATTGTCATGGAAACACTTTTTGCAGAA
ATATTGCAATATTTTACTGGCTAAGAACATAGACTTAAAAATTTACAATTGTATATTGAG
AAAGTTCTTAAGAAAGAGTTTGGCAAAGTCAGTCTAATAGAAGATGAGACAGATATAAAG
GAAGGCAAAAAGAGATTTTTTATTTAATCTGAAGATAATAATAAGGAAGTTTCCTTCGAA
GTTTATGCATATGACTAAATAGATGCTATAGACTAAATCTATATTGAAATAAACTAAAAA
AAGCGTTAGAAAAAATGA


>TTHERM_00316189(gene)
ATGAAAAACCTAAAAAAAGCATTAGCCAAAAAGCACGAAGAATAAAGCTTGAAAAACAGT
CAATAAGATTCTGTTATTTTTGCTAAAAATACAGAAAACTTCTTAAAGAGTGACTCAAGC
AGTAGTGACTAAGATGAAGAATTTGAAGAAAAACAACTTCCTGTTATCAAGAAATAATAT
GGATTTAATGGAATACCAAATAGTTATGCTTTCAAAATAAACGATGAGTCAAGCGATGAA
GATGATGAAGAAATTTTTAAAGATTAGGTATCTCCTAAAATAAATGAACAAGGCAAAAAT
ACGATTTACGAAATTAGAAACTATTAAAAGGAGTTGTTTAAAAATTCTTATAGCAAAAAT
AGTATCATTTATCTTGAAACAGGTGCTGGAAAGACTATGATTGCCACAATGCTTATAAAT
TACTTTTTCTAAAAACAAAAAAAGGCTCCATAAAAAAAGAAAATTATTTTTTTAGCCAAC
ACTGTATAGCTTGTAAAACAATAGTACGCAGAAATAAAGAATAATTTACAAAGAATTTCA
GAGATGATGGAAAACGATAAAGAAATCAGCTAGATATTAAAATTTTAAGAAGGCATTAAT
TACAGAAGAATATTTGAAAAAGAAAATCATATTGTGAAGTGTCATGGTAGTTATAAGCAA
AAGGATAATTTATAAATAGAAACTTTTACTAAATAAAAATGGGACTACTTACTTGAAAAT
TATGAAATATTCGTTATGATTGGTTAGGTATTGTTAAATGGTTTACGTAGAGGTAATTAA
TTAATTAGTCATTAGTAGATATATCTTTTATATATCTTAATTTAGAATAAAAAGATATAT
TTCATATTAATTATTAGAATTTTTAAGTATTTGATCAAAGAAAATAACTTTTCTTAAATT
ATTGTTATTAATTAGGATACATTCGCATTGAAGATATTGAGGTTATTATTTATGATGAAT
GTCACCATACGAGATAAGATCATCCTTATTGCTTAATATAATATGAGTTCTATCACTTTC
ACAAAAGACGTAACGAATAGGTTTAATTGCCAAAGATTTATGGATTAACTGCCTCTCCAG
TTTTGGATATAGAAGTAAAATCTGATTCAAATATCATGAAGAAAAAAATCTCAGAACTCT
GCACAAATTTAGATGCAAATTTTGTAAAGTATAATATCGAGGAATCTAAAAAATATATCA
AAGAAGCTACAATTTGTGTTGAAGAATATGGTGAAGAAAAGAATATTTAAGAAAGAGTAA
TTTTATAAAAAATATATTTAATTTAATATAAAATTTGTAAATAAAGGCAAATTAGTTCTT
ATAAGAATAAATTATTGGAGAGAAGTGGATTTCTGACATAGAAGATAAACAGAATGAGGA
AATGAGATACACTGAGATTTTAAATTTCTATATTAAATTTTAATAATTTAAGAACTCATA
TTTTAGCAATTTAAGTCCAATGAATAAGTAGATATTGCTAGATATAGAAAAAATTATCTG
CTTATATAGCATGCAAGTTGATGCTCAGTTAGGAAAATATTCTGTCAGTTTATTTTTGAA
AGATGTTAATGATGAACTATAAAAACTTGGCCAATTTTAGCACAATAATGAAGAAATGTA
GGAATTAAAAAAACTATTCAAAGCTTAAACAGAAAAATTTATAGAATCAGTAGATAAAAG
TGAAAAAAATATTTCTAAAAAATTCATGTTTTTGTATAATAAATTAAAATAAACAATGAT
ACATGATAAAGAAGAATTTGAGTGCTATAAAGTCAAAAATAAATACTACGAATAAGAATT
TCACTAACATGAGAAAATAACTAAAGTGTAAAAATACATTAAGGATAATTAATCGATGAT
TTTAGTTTTTGTTGAAGAAAAAATTATCATTAAATACTTGCAGAAGCTTCTTTAAATTTG
GATGGATGATGAAGATAGAGATAAAGATGAAGATGAAATTATTTTTAGATATAAAAAAAT
TGTTTGCTTAACAGGCTAATCAAACTTCTAGGATCGAAAGAAGAAAAATTTAAATAAAAA
TTAATATTAAAACTCTGAATTCACATAAAATGATAATTTTGAATTTGCTGAAGAAGAGGT
ATTATTATTTATTTTCTTTTCTTTTTTTTAATTTATTTTATCAATTGATAAATAGTATAG
GCAGTAGCAAATGAAATAGGAAAGCTTAATCAGCAGTTAAATAAACAAAGAAGAGGATAT
AGACTCCTTGAAAGAAAAAATTAATGATCACTAAAAATCTGCTTAAAGATGTGTTCTTGT
TAATCTTGATTTTGAAGTCAGCAAATAATCTGAAAACATTGAGGCGTAAATTATTTTACA
AAATAGAAAATATTTATTTATATCAATATAAAATTAATTCTTAAAGATTCAGAAAAAAAG
AGTTGTAAATAATTCTCTCAACTAGTGTAACTGAAGAAGGTTTCGATATACCTTCCTGTA
ATTTGGTTATTTCGTTTAATAAAATATCTAACTTGAAGTCGTTCGTTCAAATTAAAGGAA
GGTAATAGATAAATACTTTAAGATAAAAATTTAAACTTTTAAATTGAAATATTTTAGAGC
GAGGAAAGAAAATTCGAAGTTTATAATCATGGCAAAGGACAAATATCAAAAATAAGATTA
TGAAACAGATATTGAATCTTACAAAGATTTAATTTAATAAATTAAGGAAATAGCTCCAAA
AGTTGAGAAATAAGAAATTGAAATCAGACCTAATTATAAATATAAGATTGTCAAAGTAAA
TAATAATTTTTTGTTTTTTTTATTTTAGCTAACTTTCAATAAAAATTAGGAAACTGGGGC
TATTTTAAATACAAATTGGTCTGTAAATCTGTTTCATACTTATGCTAACTAGCTTCTTTA
TAGCTATGATTCGAATATCAAGGGACCTTTTTACTATTATATTGAGATTACAAATGTTGG
CTTTATTTGCTAAATAATTGTTCCCTCCTAATCTGGATTAAAAACATTTTGCAGCAATCC
TTAGGCTTAAAAAGAGGATGCAAAAAAAGATGCATGCTTTTAGGCTGTTATCATTCTTTA
CAGATAATATAAAATTTTTGACTAGGTATTATTATCAAATAAAATTTCAAAACTTTGTTA
AATTAATTTATTTTTAATAAAAAAGTATCTGAGAAACATATCTTAGAAGATACAAAATTC
ATAAAGTGAAAAATCAGAATCTTTATTTGAAGACGAAAAAGATGAAAAACTCACTAAAAT
ACTATAAAAATATTGTAAATCTTATGTAGATGTAAAACAAAAATGTAAAATGTACTACTT
TTAGTCTGTTATGGGAGAGTGCTTTAAATAAAGTTTTTTTAAATCTATTTTAGATATTTA
GTAATAAAAAAGTTATACATTTTAATTGTACTTGATAAAGTTCAATGATTAAGGGAAGAA
ACTCCCTTCTTCTGGTTTTATAAAAAACTAAGATTCTGAATTAGGTATCATACACAGCAC
TTAAATTCCTATAAAAGATACAATTAAATACTATCTTTAAATGCATGAAAATGAAGTTTA
TGCGAATATGATATATTAGTAAGAAATTTAGATAAGTCAATAATAATATGACAAGCTAAT
GTTGATTAATAGATTTTTAAATTCTGTTGCCCTAAATAAAGATATTGAGTTCTATGCAGA
ATATACAGGAGAAGTTGTAAATGGCAAAGGGAAATTATTTAAAGATCATGGTAAAAATGC
TAGCAAGAACTTATAATATAAATTTGATAACTCAGAAGGATTCAGTGCACTACTCACTGT
TATTAGGCCATCCAATAACAATACAAATCTTTATGAAATCAATTTTGATCATATTGAAAT
ATTAGAAAAGTACATTAATTACATGAGTGGTAATAAATTATTTTAAAAATTCTTACAAAA
TTTAAAAAAAATATAGCATAATAACTTAGTTTTGAATTGCAACAAATAAATCGTTACAAA
TAGAAAAAAAACTTTAAGAGAAAAAATCTTTTTTTTATTTAAAAATCTTAATAGAAAGCA
GTTAATTTTTTAAGAGTAATCTGATTTTATTAATAATTTTAATTGGTTAAAAACTAAATA
ACTAAATATTTCCTCAATTTTTGTTATTTTAATGTTAAAATATTCTTCAGATATTAAAAA
AGAATCAAAATTATTTAATTTTTGGAAAAATATGACTAATAATTTTTTTTAGGAGTTTAT
AAAGTTAGAAACAAGACTAAACTAAATGAAGAAGAGAAAGCAGCTAGGTTTTAAAGTAGA
AAATTAAAATAAGATGATCCATTTGCTGATTATAAAGTCAAACCTTATTATGACTGTGTA
AACTTTTTTGATTGTACTAAGTAGCTAGATCCAAATATTTATTAAGATTCAAGAAAAAAA
TTGGTGTTACAAAGCATCATGTCTGGAAGACATCTTAATCGTTTTATATTTTATGGGTGC
AAAAGCTATGAAGAAATCTAAAAGGAGTATTAATAGGTTCCCACGGGAAAAGATCCTTTT
AAGTAAATAAAATAGTTAAAGGCTTAAGTTGAGTTGGAGGAAGTCTCATTTACTTCAAAT
GAGAATCATATGGTATTATAGGTTTAGCTTTTTACTAAGCATTTGAGAAGTTAAACCAAC
TTATATCTTAAAAGAGTTGGCGTCCTGACAGAAAATTTTAAGGGTGATTATAAATATTCC
CCTCACTAGTTCACTATATTTCCTTTAAATGTTAGTCTTCTTATGAAACTTAATATTTTG
CATAAAACATTCCTTTACTAAATCAGAGACACATTTGGAGTGCATCACTTTTAATAAATC
CGTCTTCCTAAATTTTTTGATAAGGCTTATTAGAGAATCAAAAATAATAATAAAACGAGT
TGCTCCTATAACCTTGATTAAATTGAATAACCTCACTTTTTAGTAGAAAATTATTAAGGA
GTTTTAGATGTTATGAGCAAAAGTGAAAAATATAATTAATTTTGTAAGAAGTACAATAAC
CACCAACTAATGGAGGGATACAATCAGATAAGCATTAGAAAATTTGATTAAAAATATATA
AAACATAATCCTATATTTGAATCATATTAAGTATATAAGAAAAACATCTTTGAATTGTAG
ATTAGCGAGTTAATGAAGTCTTTGACCTCTCTAGAATATGCTGTTAACAATAAGGAATCA
TCACTAGAAAGATATGAATTTCTTGGTGATACAGTTTTGAAATGTTTATCTAGTACACAA
ATCTATTTTGAACACCCTAAAAGCATGGAAGATCATCTCCATGTTCATAGAACTATAATT
ATACAGAATAGAAACTTGGCATAAATTGCTGTAAAAAAGAAAATATTTAAGTAAAATAAA
TTTTTAGAATATGACTCATTTTAATATTTTTTTTTTTAGATATATTTTATCTTCTAAGAT
TGAAACGCTTTCTCCCATAGGAATAAAATATGAAATAGCAGTAGACGATGATGAATAAAA
TTAATTCTAGAAAGAAAAGGAGCCAGATGAGTACGATAAAGCTGACTAAAGGAATAAAAA
TAAGAAAGGCAATGAAGAAGATGGAGATGCAGAAAATGAAGAAATTGAAGAATAATAATA
ATAAAATGACATTCCTAATTTATTGCGTTTAGAACCAACATATCGCCACATTAAAGGAAA
AACTTTAGCTGATACTTTGGAAAGTATAATCGGTGTATTTTTTTAACAGAAAAAGGATTT
AAATCTTTGCTAATATCTTTTGTTCTCATTGTAAGTTCTCAATAAGCCAGATTTAACTTT
TAACCATAGCTATGATAGAAGCCTGCAGTAAAGTTAGCTGTAAAACCCTATTTATGTCCA
ATTGAAGGAGATAGAAAGTATTTTAGGCTATACATTTTAAAATATAAACCTCCTATTTTA
AGCCTTCACACTTCCAAGCATTGAAAGTCTTTGTATTTAAATCCCCAGTTTAAAAAATAC
AAACTTAAATAAATTGCATCAAATAAATAATGCTATTTAAAAAAAAGAAAATTAAGGAAC
ATTTGAAAAAATTGATTAAATTAGCAAAGAAAATCAAAATAAAATTTACTAAAAAGATTC
TAATGAATGGGAAAATTTGAAAAATTATAATCTGTGCAATCAAAGATTAGAATTTTTAGG
AGATGCAGTCCTTGATTTAATTATCGTCGAGTATTTATTCAACAAGTAAATTTTAATTTT
TTTTCTTTCAAACTAAATATTTTTACTTTAAATGAAAATATTAACATCAACAATTTCATA
AATTAGATTTCCTAACTCTGATCCTGGTGAGTTGACATAAATGAAAACTTCATTGGTACA
AAACAAAACCCTCTGTTTAATCAACTTAATGAAGGGATTTTATAAATTTATCATTGGAAG
CATTTAACATAATAAAGAAGAAATAGAATTATTGCTCAATAATGTTGAAATGTTTATGGG
AGATACTTCTTTAATGTACGATACAACTTATAATTAATCATTAATTAAGACATTAGGTGA
CGTAATTGAAAGTTTAGTTGGAGCGATATTTATTGATAATAATTTAGACTATGAAATTAC
CAAAAAAATTGTCATGGAAACACTTTTTGCAGAAATATTGCAATATTTTACTGGCTAAGA
ACATAGACTTAAAAATTTACAATTGTATATTGAGAAAGTAAAAACAATAATTTATATAAA
AATTAATATTAATATGAATAAATAAAATATTGAAATAGGTTCTTAAGAAAGAGTTTGGCA
AAGTCAGTCTAATAGAAGATGAGACAGATATAAAGGAAGGCAAAAAGAGATTTTTTATTT
AATCTGAAGATAATAATAAGGAAGTTTCCTTCGAAGTTTATGCATATGACTAAATAGATG
CTATAGACTAAATCTATATTGAAATAAACTAAAAAAAGCGTTAGAAAAAATGA