Identifiers and Description

Gene Model Identifier

TTHERM_00313410

Standard Name

None

Aliases

PreTt03528 | 30.m00337 | 3810.m01949

Description

transmembrane protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 71.8%

TetraMine Data

TTHERM_00313410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03352.19.997093137033517e-262hypothetical protein (1545 aa)
OxytrichaContig10580.0.g1045.002382393859839e-46Domain of unknown function (DU
F4215)
Stentor CoeruleusSteCoe_66270.0000000000002543665647376923
WormBaseWBGene000169130.000005000363240844623locus:lam-2 Laminin-like pro
tein lam-2 status:Partially_
confirmed UniProt:Q18823 p
rotein_id:CCD66855.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313410(coding)
ATGTCTTTATTATTCATTTCAGTGATTACATTTTTAATAAAATATACAATATCATAGGTA
TAGATTCTAAATGAAACCTTTAAATAATTAACTTATGATGATAATCTTGCTAACACTGAA
AATTATTGGGTTAGTTAACCACCTTTTAGTGAAGGTGGAATAAGTTACTAATGTTTAAAA
AGTCTTGAATTCTAGCCATAGCTATTATTAATGGGACCAAATTAGCAGCTCACTAAAGTA
TTTAACGCACTATCCTTGACTAAAGGAAAATATTTTTATAAGTTTAATGTGACTTTAAAT
CTTCTCTTAATTGATATGAATAGATCAAGCTTTTCTTTATCTCTTACTTTTAATGGGAAA
TCAGTAACTTTTCCTTAATAAGGATAGAGCAGTTATACTTCAAATAGCAAAGATTTTTAT
TGTTATGAAGCTTTGACATATCTAATACCATGCTCAGATTACTGCTTTGGATAAAAATAT
GATTCTTAGATTAGTATAAGCAATATGTTTTCAGGTTATCAAGATAATATTTAAATTTAA
TTAAGCTCTAACGCAATCAATGATGAATAAGTTGGGATTATTAGCTTACAGATAGAAGCT
TATCTCTGTGACCCTAATTGTTTGAAATGCTAAAACAGTCCAACTTAATGCATATAGTGC
TAGAATAGCTCTTAAGCAATAGATTTCGAATAATAAAATTGTGTTGATAGTTGCCCATCT
GGATATTACTAAACGAATGATGCTTCATATCCCCTTTAGCAAGTTTGTAAGAAATGCGAG
GTTTAAAATTGTGAATAGTGCACTAGTGGAATGACATGCTTTAAATGTTCAGATGGATAC
TATTTTGATGGTAGTCAGTGTTCTTAATGTGATAGTTTATGCGGTACATGTTCAACATCA
GCTTCTTTATGTTTGACTTGTAGTGATGGATATTACATGGCAACTGGTAGCATATGTACT
CCTTGTCCTACTGGATGCTCATCTTGCTCATCTAACACTTATTGTAGTTCATGTAATGAT
GGTTATTACTAGCTAAAAGTGGATAGTTAAACAGCAACATGTAATCCTTGCTTGTAGAAT
TGTAAATCTTGCACAGATAATACGTCTTGCAAAGAGTGCTTTTAAAATAAATACTTATAC
AATAATGACATCAGTAAAAATTATTACTATTAATGCGTTACTGACTGCGGTAATAATTAA
TTTATTTCTAATGATAACTCTAAATGTATAAAGTTTTAAGATTCAAATTGTATAAATGCT
TCCCCTTCATAAGGTTGCTAAAATGGTAATTGTAATTTTCCTTAATATTCAAATTTCCAA
AAAGAATGTGTTTAAAGCTGCTAAGATGGGTTTTACAAAGGATTTAAAGACCCAAGTTAA
ACTTTTACATAGTGCTATAAATGTCCACAGGGAAACTAAAAATGTAGTTCTTAAAATTAT
TCTATCTAATGTGAAAATGGATACTATTTATAACATGTAAGTACACAGCAGCAAAATTGT
TTATAGTGTGAATAAAATTGTGATTCGTGTACAAACGGAGTAAGTTGCAAGAAATGCAGC
AAAAATTATAATCTAGACGGTGCTACTTGTGTATAAGAGTGCTCAGGAAGTTAGTATAGC
TAAGATTAGATTTGTAAGAATTGTCCCATATAAAATTGTTTAAAATGTAAAGATAATAAA
GTGTGTGTTAAATGCAAACCTGGCTATGATATAGTAAATGGCATATGCGAAATTTCATGT
ACAGATGGTTAATTCCGCAGTTTAAAAACTTTAAAATGCACTAGCTGTTTAAGCGGATGT
AAAGTTTGCACTAGTTTAATCGGCTGCTAAGAGTGTTTTCCAAGATACTTTGGACAATAA
ACATGTTCTAAATGTGATTAAAGCTGTTATAATTGCCAAGGACTATCACCTAATCAATGT
ACCTCTTGTGATCCTTAGTCAAATCTATTTTTATATCAAAATTAATGTATCCCAAAATGT
CCAAATGGTTACTTTAACGATACTTCGTCGATGAGCTGTGTACCTTGTAATGATCCTAAT
TGTAAAGTATGTGATAAAGGAACTAATACTTGCTCATTATGCAGTGATCCTGACTTATAT
CTGGTAGATAATTAAACCTGCTCTTCAACTTGCTAACAAGACCACTAAAACTTTACAAAA
AACAATATTAAATAATGCCTTAAATTATCTTGTCCTACTGGATATTACTAAGTTGAAGAT
AAATGTAAAGAAATATGTGGAGATGGCTTAAATTTCGGCGAGTATCAATGCGATGATGGC
AATAATCTAAATGGAGATGGTTGCAGCTCAATTTGTGGGATAGAATATCTCTTTGTTTGT
CATAAAGAATCTAATCATGGTAAAAGTATTTGCTATCTTCCTCTTTCTTATAAAGCATCT
TCTCAGAATAAAAATTAAGTTATTTTATAGTTTCTTACAGATGTTCAGGTAACTTAAGAT
TTTATTAAGTACTTGAAAATATCTCTAGAAGGATTAAAATCTTCTGCATACACCTATGCA
CTTTCAAATTCAAAACAGAGTAATATGATAAAGATTGAGTTTTAATTTAACATTCAAGTT
TAAAATACAATCACTACTATCATTTAAAATGGCCAAATACAAAATGTTGAAGAACTTACG
CTTACTAAATCTCCAAAAGGTTCCTACATTTTAGATGCAGCAACTCAAACTGTGTAAATG
AATACTGAATATGTTGCTTAGGAATCGTAAAAATAAGCAGCTTAGAGTATTTAAGCCACT
TCTAAAGCTATTTCGACAACAGTAATAGCTTCTCTAGTTCCAATAACTCTATCAGGTGGA
ATTACCCTAGTTGCAAGTATTATTGATATTGCATAGATCATAAAGCTTCATAAATATTTA
GATATAGAATTTCCTGTTAATTTGGAGCTCTATTTTACTGTTTTTGAAGATTTTTCTTTT
CCTTTTGTAACTAACTTTTTTGAGTACGCTATTCCTGAACACTATGAGAAACCTACTTTT
GAAGTATTTGAATAGAAAGATCTTCAAGCTCTTTTTATCAAGAATGCAGGATAACATTAT
ACTTTGTTTATATTTACTGCGGCTGTTCATTTATTGCTTAAGCTCATAGGAATTAAGTTT
AAAATGATTGGTAAATTTGTTGATAAACTTTTTATTTATGCCATATATCATGAAGTAGTT
ATGTCTGTCTATTTAGAATTAGTTTTCAACATTCTTTTATAGTTTACTAACATGAGTGTT
GAAAAACCAGTAGACTACCTTAATTTAACAGTTATGATGTTAACTATTATTTTTGTTTTA
CCAATTCCCTTTGCTGCTGCTTACTTGATGAAAAAACATTTTCATAGACTCAAAGAAAAG
GATATTGAAGAAAAATTTGGTAGCTTGTATGAAGGATTGAAGCATGAGTATATCTGTATG
ATATACTTTATCATTTTACATTTTAGAAAAATATTAATTTCTTTGTTGATAATATACTTC
TATCAAGTAACTATCGTCTAATGTGCTATTTTGTCTATCATGCCTCTACTTCTGTTAGCT
TTTGTTATTAAAAAACAGCCTTTTCAACATAAAAAGGAGAACATCAAAATGATAATTTAA
GAAATATGTTTTTCAATTTGCTGCTTTTTATTTATTGGATTAAAATCTATGGATGGCTCA
CTTGAAGAAAATAGAATCTAAATTAGTTGGGCAATTATTACATTCTTTACAATAATACTT
CTTCTCCATTTTTATTTTAGCATGAGAGAAATCTATTATGTTATCCTTAAAAAACCTACA
CAATTTATATTTGTTATAATTGTTAAATTTTGCTAGAAGCTCAGAAATCAACCAAAAAAA
GTATCTCCATAATCAACAATATCAAGTAAAAAGGATAATTAGGACTAAATTTTTGAAAAA
TAAAACTTATAGAAATCGATAATCTCATGTAATAATAGTTATAGTAAAAAAAGCAGCATA
GAGTAGTAATTAAATATCAATAACTAAGAATATAAAAAAAATTATAGTAAGGAGGATGCT
GCAAGTATTGAAAATTATTGCATGATTGATTAAGCTAAACAGAAAACAGCAAATATTATT
TCAAATAATCAAATATCTTGTTAAGATTTTTCTTAAGTAAATACATTTAGAGAATTACAG
TTTTAGATGGCAGAGGATGCTGCTTAAAAAATAGAAAATTTAGTTCAGGATGCTCCTTAA
AAAATAGAAAATTTAGTTTAGGATGCTCCTTAAAAAATAGAAAATTTTATTTAAATACCT
TTTGGCAGAAGAATACCAAGAGCTTTTACATACAAAAATCTTTTTAAAAATTAAGAAAGC
GGGTTTTAATCTCCAAATACTAATAGAAATAGCACTAGATTTACAGAGTTTCCATCAACT
TTATTAGCACAGTAAAGTTCATGTGATGTTTCTTTTAGTAATAAGATCTTAGCAAATAAT
AATTAACCTTTAATAGATAGTCCAAGCGACAGTGCTAGGCAGATATATAAGTCAAAATAC
TCAAATATAATTTACCTAAATAACTCTCCTAAAAAGAATTAAGATAGTGAAAAAATAATA
GAAAATGAAGATGACTTTAATAATACAAATTAAATATAAATCCAAAAATACATACGAAGA
TAAGAAAATAAACAAAATTCTTTTCTTAAAATATAAAACTCAAATGTAAATACTAATAAT
TAAAAAATCTAATAAATAGAAACTGTCCCATATCAAATATAATAAGAACAAAATTCAAAA
GAATTTAAACATGATACTCTGTAAGATTTATAAATATAGGATCTTTAATAATAGAAAAAT
TCTGATGATGATAACACCATTCAGTAATAAATAAAAAGTGGATTAGTTATCAAAAGCCTT
AAAAGAATATCTGTATAAGAAAATAATTTATAGTAATCGAATTCAATAGAGAACCAAAAC
CTTGAATATAAAGATTAGTCAGAGAAAATAACAAGTTTAGAAAAATTAAATTAAAAAATG
AATTTAAATAAAGATAATTAATCTATAAAACTTGCAGAAGAAGATGACTTTGATTAAAAT
TTCTCAATAATTTAATCAAGTAAATCTATATTTTTTAGGTCTAAAAACTAATCTTAGACA
GGAGTAGTAACATCAGGATATTCTAAATTTCACTAAAAAGGCAAGAATAACACTATACTA
GTAGGTTAATAGTGA


>TTHERM_00313410(protein)
MSLLFISVITFLIKYTISQVQILNETFKQLTYDDNLANTENYWVSQPPFSEGGISYQCLK
SLEFQPQLLLMGPNQQLTKVFNALSLTKGKYFYKFNVTLNLLLIDMNRSSFSLSLTFNGK
SVTFPQQGQSSYTSNSKDFYCYEALTYLIPCSDYCFGQKYDSQISISNMFSGYQDNIQIQ
LSSNAINDEQVGIISLQIEAYLCDPNCLKCQNSPTQCIQCQNSSQAIDFEQQNCVDSCPS
GYYQTNDASYPLQQVCKKCEVQNCEQCTSGMTCFKCSDGYYFDGSQCSQCDSLCGTCSTS
ASLCLTCSDGYYMATGSICTPCPTGCSSCSSNTYCSSCNDGYYQLKVDSQTATCNPCLQN
CKSCTDNTSCKECFQNKYLYNNDISKNYYYQCVTDCGNNQFISNDNSKCIKFQDSNCINA
SPSQGCQNGNCNFPQYSNFQKECVQSCQDGFYKGFKDPSQTFTQCYKCPQGNQKCSSQNY
SIQCENGYYLQHVSTQQQNCLQCEQNCDSCTNGVSCKKCSKNYNLDGATCVQECSGSQYS
QDQICKNCPIQNCLKCKDNKVCVKCKPGYDIVNGICEISCTDGQFRSLKTLKCTSCLSGC
KVCTSLIGCQECFPRYFGQQTCSKCDQSCYNCQGLSPNQCTSCDPQSNLFLYQNQCIPKC
PNGYFNDTSSMSCVPCNDPNCKVCDKGTNTCSLCSDPDLYLVDNQTCSSTCQQDHQNFTK
NNIKQCLKLSCPTGYYQVEDKCKEICGDGLNFGEYQCDDGNNLNGDGCSSICGIEYLFVC
HKESNHGKSICYLPLSYKASSQNKNQVILQFLTDVQVTQDFIKYLKISLEGLKSSAYTYA
LSNSKQSNMIKIEFQFNIQVQNTITTIIQNGQIQNVEELTLTKSPKGSYILDAATQTVQM
NTEYVAQESQKQAAQSIQATSKAISTTVIASLVPITLSGGITLVASIIDIAQIIKLHKYL
DIEFPVNLELYFTVFEDFSFPFVTNFFEYAIPEHYEKPTFEVFEQKDLQALFIKNAGQHY
TLFIFTAAVHLLLKLIGIKFKMIGKFVDKLFIYAIYHEVVMSVYLELVFNILLQFTNMSV
EKPVDYLNLTVMMLTIIFVLPIPFAAAYLMKKHFHRLKEKDIEEKFGSLYEGLKHEYICM
IYFIILHFRKILISLLIIYFYQVTIVQCAILSIMPLLLLAFVIKKQPFQHKKENIKMIIQ
EICFSICCFLFIGLKSMDGSLEENRIQISWAIITFFTIILLLHFYFSMREIYYVILKKPT
QFIFVIIVKFCQKLRNQPKKVSPQSTISSKKDNQDQIFEKQNLQKSIISCNNSYSKKSSI
EQQLNINNQEYKKNYSKEDAASIENYCMIDQAKQKTANIISNNQISCQDFSQVNTFRELQ
FQMAEDAAQKIENLVQDAPQKIENLVQDAPQKIENFIQIPFGRRIPRAFTYKNLFKNQES
GFQSPNTNRNSTRFTEFPSTLLAQQSSCDVSFSNKILANNNQPLIDSPSDSARQIYKSKY
SNIIYLNNSPKKNQDSEKIIENEDDFNNTNQIQIQKYIRRQENKQNSFLKIQNSNVNTNN
QKIQQIETVPYQIQQEQNSKEFKHDTLQDLQIQDLQQQKNSDDDNTIQQQIKSGLVIKSL
KRISVQENNLQQSNSIENQNLEYKDQSEKITSLEKLNQKMNLNKDNQSIKLAEEDDFDQN
FSIIQSSKSIFFRSKNQSQTGVVTSGYSKFHQKGKNNTILVGQQ


>TTHERM_00313410(gene)
ATGTCTTTATTATTCATTTCAGTGATTACATTTTTAATAAGTAAATATATTTATTTAACT
ATAAATTACATTTAAATAACGCTTATGCTTAACTAAATTATCTAGAATATACAATATCAT
AGGTATAGATTCTAAATGAAACCTTTAAATAATTAACTTATGATGATAATCTTGCTAACA
CTGAAAATTATTGGGTTAGTTAACCACCTTTTAGTGAAGGTGGAATAAGTTACTAATGTT
TAAAAAGTCTTGAATTCTAGCCATAGCTATTATTAATGGGACCAAATTAGCAGCTCACTA
AAGTATTTAACGCACTATCCTTGACTAAAGGAAAATATTTTTATAAGTTTAATGTGACTT
TAAATCTTCTCTTAATTGATATGAATAGATCAAGCTTTTCTTTATCTCTTACTTTTAATG
GGAAATCAGTAACTTTTCCTTAATAAGGATAGAGCAGTTATACTTCAAATAGCAAAGATT
TTTATTGTTATGAAGCTTTGACATATCTAATACCATGCTCGTAAATAAATTTAAGCAAAA
GTTATTTTATTTATTTATTTTTTCATTTCAATGAATAGAGATTACTGCTTTGGATAAAAA
TATGATTCTTAGATTAGTATAAGCAATATGTTTTCAGGTTATCAAGATAATATTGTAATT
ATTTATAATTTTTCGAGATTTACTTAATTTAATTTTTAACCTGAATTGTTTGTTATAAAT
AAATAATCCCGAATTCACCAAACTATTTAATAATCAAAGAATTATTCTGCTATATATTTA
GAAACTGAAAATTAGTTTATAAGCGTAATTAAAGCCATTTTTTAAATTAAAAGAATGCTT
TTAATAATTTCAATAATATAAATGTAATTTACTGTAAACAATATTGTTAATTACTTAAAA
AATAAAATTAAGTTTGTGTTATAATTAATGATATCATTTTGATATTGAAATACTTAATTG
ATTTATTTTTTATAAATTAAAACATTATAATGGGCTAATTTTAAATAACTTTATTTATTT
AAAAACATTTTTTCGATTTTCGTTTGTTTTTTTAATTTACATAATTTTATTTTTAATGTT
ATTTTATAAAAATGACTAAAAACCTTTTTTTATAAAGTAAATTTAATTAAGCTCTAACGC
AATCAATGATGAATAAGTTGGGATTATTAGCTTACAGATAGAAGCTTATCTCTGTGACCC
TAATTGTTTGAAATGCTAAAACAGTCCAACTTAATGCATATAGTGCTAGAATAGCTCTTA
AGCAATAGATTTCGAATAATAAAATTGTGTTGATAGTTGCCCATCTGGATATTACTAAAG
TAAATATTTTACTTTTTACATTACAAATAATATTTCTTTCCTTACAAAAAATGATAGCAA
TTAAAATAAAAATAAGAATTTTAAATTACACTTAATCTTTTCCACAATAGTTTTGCCTAA
TTAGAAAAGAAATTTGAATCTCATAAATTACCTTAGATACTAAATTAACTTAATCAAACT
AAAAATAAAAATAATCCCACCTTATTACTTTTTTAATTTAAATAAAAATACTGCATAACA
AAAAAAATATCTAATTCTTTTATCAAGTAATACTTGTTTTTTTAATATTAGCTATGATTT
TATTTGTACAAATATCTTTTTATAATGAATCCTAATTAATTGATATTTTTTTTTAATTAA
TTTAATTAATATTATAGCGAATGATGCTTCATATCCCCTTTAGCAAGTTTGTAAGAAATG
CGAGGTTTAAAATTGTGAATAGTGCACTAGTGGAATGACATGCTTTAAATGTTCAGATGG
ATACTATTTTGATGGTAGTCAGTGTTCTTAATGTGATAGTTTATGCGGTACATGTTCAAC
ATCAGCTTCTTTATGTTTGACTTGTAGTGATGGATATTACATGGCAACTGGTAGCATATG
TACTCCTTGTCCTACTGGATGCTCATCTTGCTCATCTAACACTTATTGTAGTTCATGTAA
TGATGGTTATTACTAGCTAAAAGTGGATAGTTAAACAGCAACATGTAATCCTTGCTTGTA
GAATTGTAAATCTTGCACAGATAATACGTCTTGCAAAGAGTGCTTTTAAAATAAATACTG
TAAGGTTTAAAAATTTTCAATTAAAAAATACACAATAATATTTTTTTAAACTAAAAAAAT
TTTGAGAAAGAAAAATTAACAAATTTTTGAAATAAAAAGAACCTAAATTTAAAAAATATG
GCTAGTAATTAAAAATTATTAAAAATAAAAAATAGTATACAATAATGACATCAGTAAAAA
TTATTACTATTAATGCGTTACTGACTGCGGTAATAATTAATTTATTTCTAATGATAACTC
TAAATGTATAAAGTTTTAAGATTCAAATTGTATAAATGCTTCCCCTTCATAAGGTTGCTA
AAATGGTAATTGTAATTTTCCTTAATATTCAAATTTCCAAAAAGAATGTGTTTAAAGCTG
CTAAGATGGGTTTTACAAAGGATTTAAAGACCCAAGTTAAACTTTTACATAGTGCTATAA
ATGTCCACAGGGAAACTAAAAATGTAGTTCTTAAAATTATTCTATCTAATGTGAAAATGG
ATACTATTTATAACATGTAAGTACACAGCAGCAAAATTGTTTATAGTGTGAATAAAGTAA
TTAAATTTTTTATTAATAAATTTAAATATTAAATAATAAGCTTGTAAATAAATCTTCATA
TTAATTTTTCATATAAAGATAAATAATAAAAAAAAAACATTTATAATAGATTGTGATTCG
TGTACAAACGGAGTAAGTTGCAAGAAATGCAGCAAAAATTATAATCTAGACGGTGCTACT
TGTGTATAAGAGTGCTCAGGAAGTTAGTATAGCTAAGATTAGATTTGTAAGAATTGTCCC
ATATAAAATTGTTTAAAATGTAAAGATAATAAAGTGTGTGTTAAATGCAAACCTGGCTAT
GATATAGTAAATGGCATATGCGAAATTTCATGTACAGATGGTTAATTCCGCAGTTTAAAA
ACTTTAAAATGCACTAGCTGTTTAAGCGGATGTAAAGTTTGCACTAGTTTAATCGGCTGC
TAAGAGTGTTTTCCAAGATACTTTGGACAATAAACATGTTCTAAATGTGATTAAAGCTGT
TATAATTGCCAAGGACTATCACCTAATCAATGTACCTCTTGTGATCCTTAGTCAAATCTA
TTTTTATATCAAAATTAATGTATCCCAAAATGTCCAAATGGTTACTTTAACGATACTTCG
TCGATGAGCTGTGTACCTTGTAATGATCCTAATTGTAAAGTATGTGATAAAGGAACTAAT
ACTTGCTCATTATGCAGTGATCCTGACTTATATCTGGTAGATAATTAAACCTGCTCTTCA
ACTTGCTAACAAGACCACTAAAACTTTACAAAAAACAATATTAAATAATGCCTTAAATTA
TCTTGTCCTACTGGATATTACTAAGTTGAAGATAAATGTAAAGAAATATGTGGAGATGGC
TTAAATTTCGGCGAGTATCAATGCGATGATGGCAATAATCTAAATGGAGATGGTTGCAGC
TCAATTTGTGGGATAGAATATCTCTTTGTTTGTCATAAAGGTAAAAGCTTTTTTGAAACT
TATTTTTGATTTATAATTAATAAATTTTATTACTTTAATAGAATCTAATCATGGTAAAAG
TATTTGCTATCTTCCTCTTTCTTATAAAGCATCTTCTCAGAATAAAAATTAAGTTATTTT
ATAGTTTCTTACAGATGTTCAGGTAACTTAAGATTTTATTAAGTACTTGAAAATATCTCT
AGAAGGATTAAAATCTTCTGCATACACCTATGCACTTTCAAATTCAAAACAGAGTAATAT
GATAAAGATTGAGTTTTAATTTAACATTCAAGTTTAAAATACAATCACTACTATCATTTA
AAATGGCCAAATACAAAATGTTGAAGAACTTACGCTTACTAAATCTCCAAAAGGTTCCTA
CATTTTAGATGCAGCAACTCAAACTGTGTAAATGAATACTGAATATGTTGCTTAGGAATC
GTAAAAATAAGCAGCTTAGAGTATTTAAGCCACTTCTAAAGCTATTTCGACAACAGTAAT
AGCTTCTCTAGTTCCAATAGTAAATTAAAATTAATATTTTTAAATTCGTGTTTACACAAA
TGAATGAATATAAATAAATTAGACTCTATCAGGTGGAATTACCCTAGTTGCAAGTATTAT
TGATATTGCATAGATCATAAAGCTTCATAAATATTTAGATATAGAGTAAAAAAATATTTT
AAATAATATGATATAAAATTAATTTTTTTATTCTAGATTTCCTGTTAATTTGGAGCTCTA
TTTTACTGTTTTTGAAGATTTTTCTTTTCCTTTTGTAACTAACTTTTTTGAGTACGCTAT
TCCTGAACACTATGAGAAACCTACTTTTGAAGTATTTGAATAGAAAGATCTTCAAGCTCT
TTTTATCAAGAATGCAGGTATTTAAATTTTATTTTAATGAATAAAATTTATAAAATAAAA
TATTTATTTCTAAATAGGATAACATTATACTTTGTTTATATTTACTGCGGCTGTTCATTT
ATTGCTTAAGCTCATAGGAATTAAGTTTAAAATGATTGGTAAATTTGTTGATAAACTTTT
TATTTATGCCATATATCATGAAGTAGTTATGTCTGTCTATTTAGAATTAGTTTTCAACAT
TCTTTTATAGTTTACTAACATGAGTGTTGAAAAACCAGTAGACTACCTTAATTTAACAGT
TATGATGTTAACTATTATTTTTGTTTTACCAATTCCCTTTGCTGCTGCTTACTTGATGAA
AAAACATTTTCATAGACTCAAAGAAAAGGATATTGAAGAAAAATTTGGTAGCTTGTATGA
AGGATTGAAGCATGAGTATATCTGTATGATATACTTTATCATTTTACATTTTAGAAAAAT
ATTAATTTCTTTGTTGATAATATACTTCTATCAAGTAACTATCGTCTAATGTGCTATTTT
GTCTATCATGCCTCTACTTCTGTTAGCTTTTGTTATTAAAAAACAGCCTTTTCAACATAA
AAAGGAGAACATCAAAATGATAATTTAAGAAATATGTTTTTCAATTTGCTGCTTTTTATT
TATTGGATTAAAATCTATGGATGGCTCACTTGAAGAAAATAGAATCTAAATTAGTTGGGC
AATTATTACATTCTTTACAATAATACTTCTTCTCCATTTTTATTTTAGCATGAGAGAAAT
CTATTATGTTATCCTTAAAAAACCTACACAATTTATGTAAAATAATTACAAAAATTATTT
TATTTTATTTATCTATATTTTATGAATCTAGATTTGTTATAATTGTTAAATTTTGCTAGA
AGCTCAGAAATCAACCAAAAAAAGTATCTCCATAATCAACAATATCAAGTAAAAAGGATA
ATTAGGACTAAATTTTTGAAAAATAAAACTTATAGAAATCGATAATCTCATGTAATAATA
GTTATAGTAAAAAAAGCAGCATAGAGTAGTAATTAAATATCAATAACTAAGAATATAAAA
AAAATTATAGTAAGGAGGATGCTGCAAGTATTGAAAATTATTGCATGATTGATTAAGCTA
AACAGAAAACAGCAAATATTATTTCAAATAATCAAATATCTTGTTAAGATTTTTCTTAAG
TAAATACATTTAGAGAATTACAGTTTTAGATGGCAGAGGATGCTGCTTAAAAAATAGAAA
ATTTAGTTCAGGATGCTCCTTAAAAAATAGAAAATTTAGTTTAGGATGCTCCTTAAAAAA
TAGAAAATTTTATTTAAATACCTTTTGGCAGAAGAATACCAAGAGCTTTTACATACAAAA
ATCTTTTTAAAAATTAAGAAAGCGGGTTTTAATCTCCAAATACTAATAGAAATAGCACTA
GATTTACAGAGTTTCCATCAACTTTATTAGCACAGTAAAGTTCATGTGATGTTTCTTTTA
GTAATAAGATCTTAGCAAATAATAATTAACCTTTAATAGATAGTCCAAGCGACAGTGCTA
GGCAGATATATAAGTCAAAATACTCAAATATAATTTACCTAAATAACTCTCCTAAAAAGA
ATTAAGATAGTGAAAAAATAATAGAAAATGAAGATGACTTTAATAATACAAATTAAATAT
AAATCCAAAAATACATACGAAGATAAGAAAATAAACAAAATTCTTTTCTTAAAATATAAA
ACTCAAATGTAAATACTAATAATTAAAAAATCTAATAAATAGAAACTGTCCCATATCAAA
TATAATAAGAACAAAATTCAAAAGAATTTAAACATGATACTCTGTAAGATTTATAAATAT
AGGATCTTTAATAATAGAAAAATTCTGATGATGATAACACCATTCAGTAATAAATAAAAA
GTGGATTAGTTATCAAAAGCCTTAAAAGAATATCTGTATAAGAAAATAATTTATAGTAAT
CGAATTCAATAGAGAACCAAAACCTTGAATATAAAGATTAGTCAGAGAAAATAACAAGTT
TAGAAAAATTAAATTAAAAAATGAATTTAAATAAAGATAATTAATCTATAAAACTTGCAG
AAGAAGATGACTTTGATTAAAATTTCTCAATAATTTAATCAAGTAAATCTATATTTTTTA
GGTCTAAAAACTAATCTTAGACAGGAGTAGTAACATCAGGATATTCTAAATTTCACTAAA
AAGGCAAGAATAACACTATACTAGTAGGTTAATAGTGA