Identifiers and Description

Gene Model Identifier

TTHERM_00313119

Standard Name

None

Aliases

3810.m02111

Description

predicted protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00313119

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_66130
Tetrahymena borealisEI9_03322.19.997093137033517e-262hypothetical protein (726 aa)
DictyBaseDDB_G02859979.997093137033517e-262abcF1 on chromosome: 4 positio
n 3922084 to 3924210
OxytrichaContig14340.0.g919.997093137033517e-262ABC transporter
SGDYFR009W8.000790457750669e-165GCN20 Positive regulator of th
e Gcn2p kinase activity, forms
a complex with Gcn1p; propose
d to stimulate Gcn2p activatio
n by an uncharged tRNA
WormBaseWBGene000183395.998558726299043e-153locus:abcf-3 status:Confirme
d UniProt:Q20306 protein_i
d:CCD65308.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313119(protein)
MSRHENLLRIKEINLQEEGNIKEAKQLLLKNVTKSQLPDFFYEHIAGIIVEECPTNGQEL
YELIGEFIQNGNQVSKEQTQKICVELQKQLLDQKIIKIEDKFNLVAEKLDAPITLNQVQL
IKEIDIASHGYDDAFRGTKGAANTNDEISHEELKIKLQKKEEEAVKKKQQLFERFKNEIN
EKERNLPPVQVRHHRNSEAKTQDLQLDNVNVIIGGRALLEDAKLRLTYGRKYGLIGRNGI
GKTCFMNALARSEFENMPKHLQILLVEQEMKQSHKSPIQLVLETDIEREQLLQEEQNLVT
SNNPNTAARLQEIYERLEQIDAITAESRAASILGGLGFSQEMMRNPTQQLSGGWRMRVSL
ARALFVQPDVLLLDEPTNHLDLDAVMWLEDYIINCSITVVVVSHAREFLNVVCTDIIHFF
EQKLVYYKGNYDQFEKTRTEKQAMAKKKFESQQSKIAHMQEFIDRFRCNANRAALVQSRI
KAIGKLEHVEEIIEDPTCVFIFPTPEKLRPPLLKIEDGLFGYKKESTILRGINFAVDCDS
RIAIVGANGAGKSTLLKLLVGSLELSEGQQYRSSRLRCSMFTQHHLDQLDLTLSPLEQIM
RDYPGSTQEAYRAHLGSFGISGNMSLRPNYLLSGGQKSRVAFALAVYNNPHILILDEPTN
HLDIDAVNALIIALNNFQGGVLIVSHDQHLISTVCDQIWYVKHSRLKRFNGDFEDYRTAL
ASNNL


>TTHERM_00313119(coding)
ATGTCGAGACACGAAAATCTATTAAGGATTAAAGAAATTAATCTTTAAGAAGAAGGTAAT
ATTAAAGAAGCAAAGCAATTGTTGCTAAAGAATGTTACAAAATCTTAGCTTCCTGATTTC
TTCTACGAGCATATAGCAGGTATTATAGTAGAAGAATGCCCTACTAATGGATAAGAATTA
TATGAATTGATTGGTGAGTTCATTTAGAATGGCAATTAAGTTAGCAAAGAATAAACATAA
AAGATTTGCGTCGAATTACAAAAATAATTATTAGATCAAAAGATTATCAAAATAGAAGAC
AAATTTAATTTAGTTGCTGAAAAGTTAGATGCTCCAATTACTTTGAACCAAGTTTAATTG
ATTAAGGAAATAGATATTGCATCTCATGGCTACGATGATGCATTCAGAGGAACCAAGGGT
GCTGCAAATACAAATGATGAAATCAGTCACGAAGAATTAAAAATAAAGCTATAGAAAAAG
GAAGAAGAAGCAGTAAAAAAGAAATAATAGCTCTTCGAAAGATTTAAAAACGAAATTAAC
GAAAAAGAAAGAAATCTACCTCCCGTTTAGGTTAGACATCATAGAAATTCAGAAGCTAAA
ACACAAGATTTACAATTAGATAACGTTAATGTTATTATTGGTGGTAGAGCTTTGCTTGAA
GATGCTAAACTTAGACTTACATATGGTAGAAAGTATGGTTTAATTGGTAGAAACGGTATT
GGTAAGACTTGCTTTATGAATGCCTTAGCTAGAAGTGAGTTTGAAAATATGCCCAAGCAC
TTATAAATTTTATTAGTCGAATAAGAAATGAAACAAAGTCACAAATCTCCTATATAATTA
GTTTTGGAAACTGATATTGAAAGAGAATAGTTGCTCTAAGAAGAACAAAACTTAGTCACA
AGCAACAACCCAAATACTGCTGCTCGTTTATAAGAAATTTACGAAAGATTAGAATAGATT
GATGCCATCACTGCTGAATCAAGAGCTGCTTCCATCTTAGGTGGTCTCGGTTTCTCTTAA
GAAATGATGAGAAATCCTACTTAATAATTATCTGGTGGTTGGAGAATGCGTGTCTCTCTT
GCTAGAGCTTTGTTCGTTTAACCTGATGTTTTACTACTCGATGAACCCACTAACCATTTA
GATTTAGATGCTGTCATGTGGCTTGAAGATTATATTATTAACTGTTCAATTACTGTTGTT
GTTGTTTCTCACGCCAGAGAATTCTTAAATGTCGTTTGTACTGATATTATTCATTTCTTT
GAATAAAAGCTTGTTTACTATAAGGGTAACTATGATTAATTTGAAAAGACTCGTACTGAA
AAGCAAGCTATGGCTAAGAAGAAATTCGAATCCCAATAATCTAAGATTGCTCATATGCAA
GAATTCATTGACAGATTCCGTTGCAATGCTAATAGAGCAGCCTTAGTTTAATCTCGTATT
AAAGCTATTGGTAAATTAGAACATGTCGAAGAAATTATTGAAGATCCTACTTGCGTCTTC
ATTTTCCCTACTCCTGAAAAGCTCCGTCCTCCCCTTCTTAAGATCGAAGATGGTTTGTTC
GGATATAAAAAGGAATCCACAATTCTCAGAGGTATTAACTTTGCAGTTGATTGTGATTCT
CGTATTGCTATCGTTGGTGCAAATGGTGCTGGTAAATCAACTCTCCTTAAACTTTTGGTT
GGTTCTCTTGAACTCTCAGAAGGTTAGTAATATAGAAGCAGCAGATTAAGATGCAGTATG
TTCACTTAACATCACTTGGATTAACTTGACTTGACTCTTTCTCCTTTAGAATAAATTATG
AGAGATTATCCTGGCTCTACTTAGGAAGCATACAGAGCTCATTTAGGTTCTTTCGGTATT
TCTGGTAATATGTCACTCAGACCCAACTATTTACTTTCTGGTGGTCAAAAATCAAGAGTT
GCTTTCGCTTTAGCAGTTTATAACAACCCTCACATTCTTATTCTCGATGAACCCACAAAT
CACTTGGATATAGATGCAGTTAATGCTTTAATTATTGCTTTAAATAATTTCTAAGGTGGT
GTTTTAATTGTTTCTCACGATCAACATTTAATTTCTACAGTATGCGATCAAATCTGGTAT
GTTAAACATAGTAGACTAAAACGTTTCAACGGTGACTTCGAAGATTATCGTACTGCACTT
GCATCAAATAACTTGTGA


>TTHERM_00313119(gene)
ATGTCGAGACACGAAAATCTATTAAGGATTAAAGAAATTAATCTTTAAGAAGAAGGTAAT
ATTAAAGAAGCAAAGCAATTGTTGCTAAAGAATGTTACAAAATCTTAGCTTCCTGATTTC
TTCTACGAGCATATAGCAGGTATTATAGTAGAAGAATGCCCTACTAATGGATAAGAATTA
TATGAATTGATTGGTGAGTTCATTTAGAATGGCAATTAAGTAAATAAATTATTTTTAAAA
TAAAAAGGAAGCAAATTTTGAATAAAATATATCAAAAAATAATCATATTTTTAAATTATT
ATTCTTAGCTTTGATAGGTGTATTTATTTATTTTTTAAAATGAAAAAAATGATTAGGTTA
GCAAAGAATAAACATAAAAGATTTGCGTCGAATTACAAAAATAATTATTAGATCAAAAGA
TTATCAAAATAGAAGACAAATTTAATTTAGTTGCTGAAAAGTTAGATGCTCCAATTACTT
TGAACCAAGTTTAATTGATTAAGGAAATAGATATTGCATCTCATGGCTACGATGATGCAT
TCAGAGGAACCAAGGGTGCTGCAAATACAAATGATGAAATCAGTCACGAAGAATTAAAAA
TAAAGCTATAGAAAAAGGAAGAAGAAGCAGTAAAAAAGAAATAATAGCTCTTCGAAAGAT
TTAAAAACGAAATTAACGAAAAAGAAAGAAATCTACCTCCCGTTTAGGTAGATTTAATTT
ATTTCTTCAAACATTTGCTTATTTAATCTAAGAACAAATTTTTAACTCCAACATAAAATT
TAAAATAATGCGCTTTCAGGAATTAATCTTAACTATTTATCTCTAAATATATAATTAATA
AATATCTTTTGATTAAAATAAATTTGATAAGCTCTTTTATTAACAAAATTCACCTTAAGT
TAATTAATAAGTAAATTTCCATTTTTACAAATTAAGGTTAGACATCATAGAAATTCAGAA
GCTAAAACACAAGATTTACAATTAGATAACGTTAATGTTATTATTGGTGGTAGAGCTTTG
CTTGAAGATGCTAAACTTAGACTTACATATGGTAGAAAGTATGGTTTAATTGGTAGAAAC
GGTATTGGTAAGACTTGCTTTATGAATGCCTTAGCTAGAAGTGAGTTTGAAAATATGCCC
AAGCACTTATAAATTTTATTAGTCGAATAAGAAATGAAACAAAGTCACAAATCTCCTATA
TAATTAGTAATTAATTAATTTATTCCCTTTTAAACTAGCAATTTTAAGTTATAATTTACT
TTGTTAAATTTCTAAAGGTTTTGGAAACTGATATTGAAAGAGAATAGTTGCTCTAAGAAG
AACAAAACTTAGTCACAAGCAACAACCCAAATACTGCTGCTCGTTTATAAGAAATTTACG
AAAGATTAGAATAGATTGATGCCATCACTGCTGAATCAAGAGCTGCTTCCATCTTAGGTG
GTCTCGGTTTCTCTTAAGAAATGATGAGAAATCCTACTTAATAATTATCTGGTGGTTGGA
GAATGCGTGTCTCTCTTGCTAGAGCTTTGTTCGTTTAACCTGATGTTTTACTACTCGATG
AACCCGTATACTATTTTATTTATTTAAAAAAATTTTACTAAAACTATTTTTTTTCTATTT
AAGACTAACCATTTAGATTTAGATGCTGTCATGTGGCTTGAAGATTATATTATTAACTGT
TCAATTACTGTTGTTGTTGTTTCTCACGCCAGAGAATTCTTAAATGTCGTTTGTACTGAT
ATTATTCATTTCTTTGAATAAAAGCTTGTTTACTATAAGGGTAACTATGATTAATTTGAA
AAGACTCGTACTGAAAAGCAAGCTATGGCTAAGAAGAAATTCGAATCCCAATAATCTAAG
ATTGCTCATATGCAAGAATTCATTGACAGATTCCGTTGCAATGCTAATAGAGCAGCCTTA
GTTTAATCTCGTATTAAAGCTATTGGTAAATTAGAACATGTCGAAGAAATTATTGAAGAT
CCTACTTGCGTCTTCATTTTCCCTACTCCTGAAAAGCTCCGTCCTCCCCTTCTTAAGATC
GAAGATGGTTTGTTCGGATATAAAAAGGAATCCACAATTCTCAGAGGTATTAACTTTGCA
GTTGATTGTGATTCTCGTATTGCTATCGTTGGTGCAAATGGTGCTGGTAAATCAACTCTC
CTTAAACTTTTGGTTGGTTCTCTTGAACTCTCAGAAGGTAATAAAATTTTAAAATAACAT
AATACTATATGATTGAAATAGAGTAAAAAAATAATACCAAACTAAAAAGCAGATTGAGTG
ATGATAAAATTGCAAATTTTCTTAAAATAGCTAAATCATTTATTATCTTGCTCCAAAACT
AATTTAATTTACAATAATTTTCATGACTAAAAAAATATCTTTAAAATAAAAAAATAAACT
TTAAAAAATAGAATAAACACTAAACTTATCTATCTGAACAAACAAATAATTTAATAATTA
ATTAAGCTAATAAAATGCATTAAAAAATAAATAAATAAATAAATAAAAGAATAAAATTAA
AATAATTTATCAAAATAAATAGGTATTAACATTAAAATCGAGAAATTATAATTTATTATT
TTATTTGTGAAACTAACTTTATTTGAATTGAATTAATATTGATAATTGAATAAAAAAAAG
GTTAGTAATATAGAAGCAGCAGATTAAGATGCAGTATGTTCACTTAACATCACTTGGATT
AACTTGACTTGACTCTTTCTCCTTTAGAATAAATTATGAGAGATTATCCTGGCTCTACTT
AGGAAGCATACAGAGCTCATTTAGGTTCTTTCGGTATTTCTGGTAATATGTCACTCAGAC
CCAACTATTTACTTTCTGGTGGTCAAAAATCAAGAGTTGCTTTCGCTTTAGCAGTTTATA
ACAACCCTCACATTCTTATTCTCGATGAAGTAATTTATAATTTTAAACATGGAAGTTATA
ATAATTTTTAAAATAAAAGCCCACAAATCACTTGGATATAGATGCAGTTAATGCTTTAAT
TATTGCTTTAAATAATTTCTAAGGTGGTGTTTTAATTGTTTCTCACGATCAACATTTAAT
TTCTACAGTATGCGATCAAATCTGGTATGTTAAACATAGTAGACTAAAACGTTTCAACGG
TGACTTCGAAGATTATCGTACTGCACTTGCATCAAATAACTTGTGA