Identifiers and Description

Gene Model Identifier

TTHERM_00312220

Standard Name

NBP35  (Nucleotide Binding Protein  )

Aliases

PreTt03410 | 30.m00219 | 3810.m01835

Description

Essential cytoplasmic iron-sulfur cluster binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00312220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03237.19.997093137033517e-262nucleotide binding protein 2 (
583 aa)
OxytrichaContig21456.0.g861.999382702437002e-145ParA/MinD ATPase like
DictyBaseDDB_G02774377.00277717908239e-127nubp1 on chromosome: 2 positio
n 8068928 to 8070071
WormBaseWBGene000086644.001709789838121e-126locus:nubp-1 Cytosolic Fe-S
cluster assembly factor NUBP1
homolog status:Confirmed U
niProt:Q93459 protein_id:CAB
02285.2
SGDYGL091C8.998157708876845e-106NBP35 Essential iron-sulfur cl
uster binding protein localize
d in the cytoplasm; forms a co
mplex with Cfd1p that is invol
ved in iron-sulfur protein ass
embly in the cytosol; similar
to P-loop NTPases
Stentor CoeruleusSteCoe_295428.408597124803643e-50

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00312220(coding)
ATGGAAAAAGAAAGAATTGTACCTGAAGGAGCTCCTGATTCTTGTCCAGGAGTCAAATCT
CAATTAGCAGGAAAGGTAGAGCCTTGCTCTGGATGCCCACATTAACCCAACTGTGCTTTA
GGAAATCCAAACTTAGATGGTAGAATCATTCCTGAAGAAGCACCATCTTAATGTCCAGGC
ACTTAATCTAACTTAGCTGGCCATACAGTAGTATGTTCAGGATGCCCCCATTAACCAAAC
TGTGCTTCAAAAGCTTTAAATGTCCATTACAAATTAGTTCCTGATAATGCTCCAACTTAA
TGTCCTGGTACTCTTTCTCAAGATGCAGGAAAAGTAAACTCTTGTTCAGGATGCCCTAAT
TAATAAAAATGTAATAGTGGATAATCAAATACTATTCAAGAGCATAAGAAGTTAGTTCCA
GATAATGCACCATAAAACTGTCCTGGAGTTGATTCATAAAATGCAGGAAAAACTGAAGTT
TGTGTATCTTGCCCTCATTAACCTAACTGCGCTTTAGGCAAACTTGGAGTTCATGGCAAA
GTTGTTCCTGTTGATGCTCCTGAATAATGCCCTGGAACATAAGCCTAAAATGCAGGTAAA
ACACCAGTTTGCTCAGGATGTCCTCATCAACCTGATTGTGCTGCTGGTAAGTAAGCAAAT
ATCACTGCTGATAAGAAAATCGTCCCAGTTAATGCTAATACTGGTTGTGTAGGAACTCAG
TCATAATAAGCAGGTACTGCTTCTTCATGTGCAGGCTGTCCTAATAAAGCTAAATGTTCT
AGTTAAAATACAGAAGAAAATAAAGTTGTACCAGACAATGCAAACGAAGGTTGTCCTGGA
ACGTAAAATAAAGAAGCAGGTAAAATGTCTGCTTGCTAAGGATGCCCCAACCAGCAAATT
TGTGCTTCTGGAAAAGCAAACGAACCTGATCCAGCTCTTAAAGACGTAGAAAGAAGAATG
AAATTAGTCAAGCACAAAATTCTAGTTCTTTCAGGTAAAGGTGGTGTTGGTAAGAGTACA
GTTTCCTCTTAACTAGCTTTCTAATTAGCAAATCTTGGTTATGAAGTTGGCTTGTTAGAT
ATTGATATTTGTGGTCCTTCAATTCCTAGAATGTTGGGATTACTTGATCACGAAGTTCAT
AATAGTGCTGATGGTTGGAGTCCTGTTTATGTAGAAGATAATTTAGGTGTTATGTCCATA
GGATTTTTATTAGGCAATCAAGATGATGCAGTTGTTTGGAGAGGTCCTCGTAAGAATGGT
TTGATTAAACAATTTTTGACAGATGTTAATTGGGGAGAATTGGATTATCTTATTATCGAT
ACTCCTCCTGGAACTTCTGATGAACACATCAGCTGTGTCTAATACTTGTAACCTGGTGAA
GGAGATGGTGCTATTGTAGTTACCACTCCTTAAGAAGTTAGTCTTTAAGATGTCAGAAAA
GAATTGAGTTTCTGTTAAAAGACTAAAACAAATATACTCGGTGTTGTTGAAAACATGAGT
GGTTTCATTTGTCCTGGCTGCAAGTGCGAAAGTCAGATTTTCCCTCCTGTAACTGGTGGT
GCTGCTAAAATGTGCTAAGATTATAAGATTGATCTCTTAGGTAAAGTACCTCTCGAACCT
AAGGTCTTAATCTGCACAGAAAAGGGTAAATCAATTGTCAAAGAGCATCCAGATTCTGTA
GCAGCTAAGGTCTACTAACATATTGCAGAAAGAGTAACTCAAACACTAAAAGTAGAATTA
CCAAAGTGA


>TTHERM_00312220(protein)
MEKERIVPEGAPDSCPGVKSQLAGKVEPCSGCPHQPNCALGNPNLDGRIIPEEAPSQCPG
TQSNLAGHTVVCSGCPHQPNCASKALNVHYKLVPDNAPTQCPGTLSQDAGKVNSCSGCPN
QQKCNSGQSNTIQEHKKLVPDNAPQNCPGVDSQNAGKTEVCVSCPHQPNCALGKLGVHGK
VVPVDAPEQCPGTQAQNAGKTPVCSGCPHQPDCAAGKQANITADKKIVPVNANTGCVGTQ
SQQAGTASSCAGCPNKAKCSSQNTEENKVVPDNANEGCPGTQNKEAGKMSACQGCPNQQI
CASGKANEPDPALKDVERRMKLVKHKILVLSGKGGVGKSTVSSQLAFQLANLGYEVGLLD
IDICGPSIPRMLGLLDHEVHNSADGWSPVYVEDNLGVMSIGFLLGNQDDAVVWRGPRKNG
LIKQFLTDVNWGELDYLIIDTPPGTSDEHISCVQYLQPGEGDGAIVVTTPQEVSLQDVRK
ELSFCQKTKTNILGVVENMSGFICPGCKCESQIFPPVTGGAAKMCQDYKIDLLGKVPLEP
KVLICTEKGKSIVKEHPDSVAAKVYQHIAERVTQTLKVELPK


>TTHERM_00312220(gene)
ATGGAAAAAGAAAGAATTGTACCTGAAGGAGCTCCTGATTCTTGTCCAGGAGTCAAATCT
CAATTAGCAGGAAAGGTAGAGCCTTGCTCTGGATGCCCACATTAACCCAACTGTGCTTTA
GGAAATCCAAACTTAGATGGTAGAATCATTCCTGAAGAAGCACCATCTTAATGTCCAGGC
ACTTAATCTAACTTAGCTGGCCATACAGTAGTATGTTCAGGATGCCCCCATTAACCAAAC
TGTGCTTCAAAAGCTTTAAATGTCCATTACAAATTAGTTCCTGATAATGCTCCAACTTAA
TGTCCTGGTACTCTTTCTCAAGATGCAGGAAAAGTAAACTCTTGTTCAGGATGCCCTAAT
TAATAAAAATGTAATAGTGGATAATCAAATACTATTCAAGAGCATAAGAAGTTAGTTCCA
GATAATGCACCATAAAACTGTCCTGGAGTTGATTCATAAAATGCAGGAAAAACTGAAGTT
TGTGTATCTTGCCCTCATTAACCTAACTGCGCTTTAGGCAAACTTGGAGTTCATGGCAAA
GTTGTTCCTGTTGATGCTCCTGAATAATGCCCTGGAACATAAGCCTAAAATGCAGGTAAA
ACACCAGTTTGCTCAGGATGTCCTCATCAACCTGATTGTGCTGCTGGTAAGTAAGCAAAT
ATCACTGCTGATAAGAAAATCGTCCCAGTTAATGCTAATACTGGTTGTGTAGGAACTCAG
TCATAATAAGCAGGTACTGCTTCTTCATGTGCAGGCTGTCCTAATAAAGCTAAATGTTCT
AGTTAAAATACAGAAGAAAATAAAGTTGTACCAGACAATGCAAACGAAGGTTGTCCTGGA
ACGTAAAATAAAGAAGCAGGTAAAATGTCTGCTTGCTAAGGATGCCCCAACCAGCAAATT
TGTGCTTCTGGAAAAGCAAACGAACCTGATCCAGCTCTTAAAGACGTAGAAAGAAGAATG
AAATTAGTCAAGCACAAAATTCTAGTTCTTTCAGGTAAAGGTGGTGTTGGTAAGAGTACA
GTTTCCTCTTAACTAGCTTTCTAATTAGCAAATCTTGGTTATGAAGTTGGCTTGTTAGAT
ATTGATATTTGTGGTCCTTCAATTCCTAGAATGTTGGGATTACTTGATCACGAAGTTCAT
AATAGTGCTGATGGTTGGAGTCCTGTTTATGTAGAAGATAATTTAGGTGTTATGTCCATA
GGATTTTTATTAGGCAATCAAGATGATGCAGTTGTTTGGAGAGGTCCTCGTAAGAATGGT
TTGATTAAACAATTTTTGACAGATGTTAATTGGGGAGAATTGGATTATCTTATTATCGAT
ACTCCTCCTGGAACTTCTGATGAACACATCAGCTGTGTCTAATACTTGTAACCTGGTGAA
GGAGATGGTGCTATTGTAGTTACCACTCCTTAAGAAGTTAGTCTTTAAGATGTCAGAAAA
GAATTGAGTTTCTGTTAAAAGACTAAAACAAATATACTCGGTGTTGTTGAAAACATGAGT
GGTTTCATTTGTCCTGGCTGCAAGTGCGAAAGTCAGATTTTCCCTCCTGTAACTGGTGGT
GCTGCTAAAATGTGCTAAGATTATAAGATTGATCTCTTAGGTAAAGTACCTCTCGAACCT
AAGGTCTTAATCTGCACAGAAAAGGGTAAATCAATTGTCAAAGAGCATCCAGATTCTGTA
GCAGCTAAGGTCTACTAACATATTGCAGAAAGAGTAACTCAAACACTAAAAGTAGAATTA
CCAAAGTGA