Identifiers and Description

Gene Model Identifier

TTHERM_00310760

Standard Name

None

Aliases

PreTt21377 | 29.m00338 | 3696.m00156

Description

Integral membrane protein DUF6 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02109 ) DAD family
  • ( PF05231 ) MASE1 domain
  • ( PF08449 ) UAA transporter family
  • ( PF00892 ) Integral membrane protein DUF6
  • ( PF03151 ) Domain of unknown function, DUF250
  • ( PF04018 ) Domain of unknown function (DUF368)
  • ( PF04657 ) Protein of unknown function, DUF606
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF00893 ) multidrug resistance protein, SMR family
  • ( PF06790 ) Uncharacterised protein family (UPF0259)
  • ( TIGR00950 ) Carboxylate/Amino Acid/Amine Transporter

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00310760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18559.19.997093137033517e-262integral membrane protein DUF6
containing protein (313 aa)
OxytrichaContig18289.0.g859.997019043202629e-21EamA-like transporter family
DictyBaseDDB_G02826731.9991095569230066e-20DDB_G0282673 on chromosome: 3
position 6100946 to 6102478
SGDYMR253C0.00000000002000577768187062YMR253C Putative protein of un
known function; green fluoresc
ent protein (GFP)-fusion prote
in localizes to the cytoplasm
in a punctate pattern; YMR253C
is not an essential gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00310760(coding)
ATGGATTGCCTATACAAATTTATTACTCGTTAAATGGAGGTTTTTGAGAAAAACAAAAGA
GCCCCATCTATTTACACTATTTTTTCCTCCATCTTTTACGTATCAGTTGGTATGGCAATT
AAGAAACTTAGAGACATCCCTCCTTGTGAAATTCTATTCTTTAGATCTATTATTTGCTTC
TTTGCTAATCTAGCTCTACTAAAGGTATCCAACACTCCTACTTATGCTACCACTAATAAG
CTCCACTTTATGATTATGTTCAGAATTCTTTTTGGTACTCTTGCTCACTTTTGCTACTAT
CAAGCCATTAGTATGATGAACTTAAGTGATGCTATGGCTATCTTTTTAACCACTCCTATA
GTAACAACATTATTAGCAAGTGTAATTCTCAAGGAATCCTTATAAAAATAAATCATCATT
TCTATATTAGTCAGCTTTGCAGGTATCCTTCTTATAGTAAAGCCACCATTTTTGATGGAA
GCAATTGGATTGAGTGAATCAGCAGCTGAATTAAGCGTTGCAGGTTTAATCATTTGTGCA
GTGTTTGCTTTATTTGAAAGTTTGACTAATCTTGTTATCAAATCAATTGGAAAGTAAATC
AGTGTTTTAGCAGTTATACAATATGTTTACATTGCAGGTATCCTCTTTAACAGCACTTTA
ATGGTTATCAGAGATGAATTCAACCCAAATGTCTACACAATTGAGAAGTTTGGATGGATT
TTTGCTCTTTCAATTTTAAATTTCTTAGCTCAGCTTATTTACAATAGAGCACTTTAATTA
GGTAAGACTTCAGAAGTTGTTCCTATCACTTATAGCTAAGTAGTTATGAGTTTTTTGGTA
GATATAGTAGTATTCTCAAAAGAAATTAGTCTTTTGAGTGTTGTAGGAGCTGTTATGATT
ATAGGAGGAAATTATTCTATCATCATGCAAAAAAAATGA


>TTHERM_00310760(protein)
MDCLYKFITRQMEVFEKNKRAPSIYTIFSSIFYVSVGMAIKKLRDIPPCEILFFRSIICF
FANLALLKVSNTPTYATTNKLHFMIMFRILFGTLAHFCYYQAISMMNLSDAMAIFLTTPI
VTTLLASVILKESLQKQIIISILVSFAGILLIVKPPFLMEAIGLSESAAELSVAGLIICA
VFALFESLTNLVIKSIGKQISVLAVIQYVYIAGILFNSTLMVIRDEFNPNVYTIEKFGWI
FALSILNFLAQLIYNRALQLGKTSEVVPITYSQVVMSFLVDIVVFSKEISLLSVVGAVMI
IGGNYSIIMQKK


>TTHERM_00310760(gene)
ATGGATTGCCTATACAAATTTATTACTCGTTAAATGGAGGTTTTTGAGAAAAACAAAAGA
GCCCCATCTATTTACACTATTTTTTCCTCCATCTTTTACGTATCAGTTGGTATGGCAATT
AAGAAACTTAGAGACATCCCTCCTTGTGAAATTCTATTCTTTAGATCTATTATTTGCTTC
TTTGCTAATCTAGCTCTACTAAAGGTATCCAACACTCCTACTTATGCTACCACTAATAAG
CTCCACTTTATGATTATGTTCAGAATTCTTTTTGGTACTCTTGCTCACTTTTGCTACTAT
CAAGCCATTAGTATGATGAACTTAAGTGATGCTATGGCTATCTTTTTAACCACTCCTATA
GTAACAACATTATTAGCAAGTGTAATTCTCAAGGAATCCTTATAAAAATAAATCATCATT
TCTATATTAGTCAGCTTTGCAGGTATCCTTCTTATAGTAAAGCCACCATTTTTGATGGAA
GCAATTGGATTGAGTGAATCAGCAGCTGAATTAAGCGTTGCAGGTTTAATCATTTGTGCA
GTGTTTGCTTTATTTGAAAGTTTGACTAATCTTGTTATCAAATCAATTGGAAAGTAAATC
AGTGTTTTAGCAGTTATACAATATGTTTACATTGCAGGTATCCTCTTTAACAGCACTTTA
ATGGTTATCAGAGATGAATTCAACCCAAATGTCTACACAATTGAGAAGTTTGGATGGATT
TTTGCTCTTTCAATTTTAAATTTCTTAGCTCAGCTTATTTACAATAGAGCACTTTAATTA
GGTAAGACTTCAGAAGTTGTTCCTATCACTTATAGCTAAGTAGTTATGAGTTTTTTGGTA
GATATAGTAGTATTCTCAAAAGAAATTAGTCTTTTGAGTGTTGTAGGAGCTGTTATGATT
ATAGGAGGAAATTATTCTATCATCATGCAAAAAAAATGA