Identifiers and Description

Gene Model Identifier

TTHERM_00310490

Standard Name

None

Aliases

PreTt21353 | 29.m00314 | 3696.m00132

Description

cyclic nucleotide-binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF07885 ) Ion channel
  • ( PF08912 ) Rho Binding
  • ( PF00098 ) Zinc knuckle
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( PF00520 ) transporter, cation channel family
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04086 ) Signal recognition particle, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00310490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18539.19.997093137033517e-262cyclic nucleotide-binding doma
in-containing protein (1966 aa
)
OxytrichaContig16023.0.g353.998862432046419e-53Ion transport protein
WormBaseWBGene000065265.0000961330688895e-23locus:tax-4 Cyclic nucleotid
e-gated cation channel statu
s:Confirmed UniProt:Q03611
protein_id:CAB63418.2
Stentor CoeruleusSteCoe_125161.4251640827409352e-21
SGDYJL093C0.000009999254677478949TOK1 Outward-rectifier potassi
um channel of the plasma membr
ane with two pore domains in t
andem, each of which forms a f
unctional channel permeable to
potassium; carboxy tail funct
ions to prevent inner gate clo
sures; target of K1 toxin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00310490(coding)
ATGAATTATGAAAATTAAGGTCGAAGCTCAAAAATATAACAAAGGATTTAAGTTCCTAAC
ATATAGCTTAATGAATAGGATTAGCATGTTTTTGATACTGATGGAATGATCTCGTCTCAG
GGAGATTGGAGTTCTCCTATAAAAATTAACCAAGATACACCAAATTAGTTCATGTAGGAA
ACATAATAGAATTTGATTACTTCAAATGATGATAATTTAGATGCTATTTCAAAAAAAAGT
AGTAGCAAAAACAACAACAACAATATCGATAGTGATATGGATTACTTAAAAAAAGTAAAT
TTAAATCTGTAAAAAAGCAAATCATAAATAGAAAAATAGGGCACAAAGGAAGAAGATTCA
GGAAAAAATCATAAAATTAGCAAGCATAGTTAAAGTAATGCTTCAATAGCACCAAGTTTT
GTATTAGATTAGTAATAGGAAGATTAATAGGCTGATTAAACTTAGAAGCATTTAATTCAA
ACTAACTAAAATTTTAATGAGCAATCAAAAACACAAAAGAATGTATTCGATGATGAAAAT
CCTCAAAGAAGATTAAGAGAATATAGAAGAACTTAATACAGAAATGTTTCTCTAAAACTT
CTTGAAAACGGAACAAACGCATAAGCTTAAGAAGCAAATTGGAATACTCAAACTAATTTA
GATATAGAAGGATTTTCACCAACATTAACATTAAATAACATTAACAAATCAAAGAAAAGT
TTTTTGGCTTTAAATGTAAACGAATGTTCCACTCCACAGAACAATCCAAACAAAATAAAA
GTTTATCCTCTTTTATCTAGTGGGGTAAGCACTGACAACTTGAGGAAGAGTTAAATAATA
AATAGAGTTTCCTAACACAGCATTAATTTAGATAAAAATGGAACTTTTAATCAATATTTA
GATTTTAATAAGGACAGACCTTTAAGCAAAGGGGATTAACTTCTCGGATTTAGCGCTTTT
GAGGGTTAAAATTAATCTCAATAACCTTCTCTAATAAATGGAATGAATATTTAAGCTTAT
TATTCATTTTAAGGGCGTACAGGAGAAAACGATTCATAAGCTCATTACAATTAAAATGCT
TCTAATTAAGTTATGCTTTCACAAAATTAGCAATATTAATCTATTGCACACAGTTAATTC
TATGCAGCTCCTTTATAAACTAATAACAACAACATAAACAATATAAGAAATCCAAGTGAG
TCTAATATAAATTGGAACATAGCTATTAAGATAAAGAATATTAGTAGATTTATTTCTAAA
GTAAGAAGCCAAACAAGTGATTTCAATAAGAAAAACTTAAAGGATTTTCACCATAAGCTG
ATTAATGATGCTTCAGATAGTAAAATATATGCTCAGAGTGGTAGTAATAATACATTACCC
TCATTGAATACTAGTCAAAAAATATAACTCCAATAATCTAATACTCTAGTGAGAGAAGAC
TCTTAAGAATAAAATTGTTTAGAGAAAGTTTTCTACAAAATGATGAATATTTTATTTAAA
AGATGTTTATATTACCTAGATAATATAATAACAAGTGAAAAATCATATGTTTTCTCCCCT
GAACAGACAATGATCGTCTTTTGGAATATTTTGTTTGGTTTACTATTGTTATTTTAGTTT
TTTTATATACCATTCTCAGTAGGTTTTGATGTGGATATAGTTGATTAAACTAAATACAGA
TTGCTATTCTACATTATTCCCATAATAGCATGCTTTATAGACTCTTTGATCAATCTAAAT
CTAGGATATTACCTGCAAGGTTTAGTAGAAATAGATAGATTAAAAATCATCAAAAGGTAT
ATAAAATAATTTCTGATAAGAGATATTATAAGCTTATTTTCTTTGATAATGACTTTATAG
ACAAATGTAAGTTATTATTCTTTGCTGTTTTTTGTTCGAATTCCTCAACTTTTCAAAATA
CTTGAAGAACATGCTGAATATTTTTAGTTAGAACAAAAATATTATAACTATTACTAATTG
GGAAATTTACTTTTTATGATATTTTACATTTCTCACATATGTGGTTGTATATTTCATTAT
ATCTCCTATGAAATTGGTGTTCAATCTTAGAATGATTTAAAGGATACATGGCTGAATGAT
GCAGGAGTTTTTTACAGTTCAATATTCAAAAGATATGTTTATTCGTTTTACTTTATAGTT
ATTACAATCACTACAGTTGGCTACGGTGATATAAAACCAATATCTGTATATGAAAAAATA
TACGTCACTATCATAACTATACTAGGTTCTTGTATATTTGCATATACAGTTAACACTGTT
GGAACAATATTCTAGGAAATTGAACGCAAAAAAGCTTAATCAAAATAAAGAAAATATGAA
TTAACTAGCTACTTAAACTAGAGGTAGGTAAAAAAGGATATTCAAATCAGAGTATTAAAA
CATTTAGAGTTTAATTAGTAAAGAGAAGATGATGACCCAATTAGAGGAATGAATATACTT
GAAAGTGTATCTAAAAACTTAAAAGAAGAGGTTTGTAAGGATTTTTATGGAAGAATATTA
TAATAGAGCAAAATATTTAACTTATAATTCTCATAGCAAGCACTTTTAGATGCTTCTTTG
TAATTTAAAGAAAAAATTTTGAGCCCAGGTGAAATAGTTTTTAAAGAAGGCTAAGCTAAT
GATCATGACATCTTTTATATCTATAAGGGTAGCATAGATCTTTTCGTTTAAAAATCAAGA
AAGTAGTAGAGAACTATTTTTACAGCCAAAAGTGGCATGTTTTTTGGACAAGGAGGTTTT
TTTAGTTCTGCTCCCAGAGAATGCTCTGCCAAGACTATTACAGTGTGTCATTTACTTGTT
TTAAGCTAGAGTGATTTCATAAAGACTCTCAAGAATCACACCGAAGATTATGAAAAATTT
TGTGTCATAAAAGATGAAATGAATATTTATAAAATTTAATAGCACATGACATGCTTTAGC
TGTGGATAGTTTAACCATACTTTACTGAACTGCCACTTAATCCATTATAAAAGAAACAGA
GATCTATTTCTAGCACGCTACAGATATAGTATCCCATAGGAAAGAAAAAAAGAAATAATA
CGTAAAAATTATGGAAAATCTTCATCTTGGAAATAAAGGTAGGTTGTGAGGTAGTCACTT
TTTTAGCTCAGACTTGACGCACTCAATTTAATACTATAGAACCCATAAGAAATAACAGAC
AAACAATTTTTTAATGGAGTAAATAAGATCAAATATGAAAATGGATTTTTCTTCGCTGAT
TATGAAGAAGATGAAGAATTGGAAAAATTAAAAAAGGAAGGGTAAGAAGATGAAGACAAA
TCTAGTGAATCTTCTTCAAGTGATGAAGAAAATTTATAGAATAAATTAAGCAATTTAAGT
GCAGCTAGTAATATTAGTAATGCTAGTTAGTTAACTTACAATCAAGATGATAGCTATAGA
TTTGGTAATAATGTACCACATTTTTTTATTCAAAACGAAAGCGCTGATATAAAGGCTGAG
GAAACTTTATTAAACTCGATCAAAGAAGTGAACGAATTAGATGAAGAAAATCACGAAAAT
AAATATCAATCATAAAAAAGAAAAACATCTTAAAATCTTTATAAGTATTCTATTTAATCT
TAAAATAGTAGAAGACCTCATGCTTAATCAATTGATGATGATAACCATTTATATCATTTT
CATAAATAATAAACTCATAAAGAAAGTAGTACTTCATCTGCAAGAAAAATTTAATCTTAG
AGATCGTTGTAATTAGTAACATATTCTAAAAGATCTGAGCTATTAGAAATTGCAAATCAA
AATTCCTTAAAAACATCTCATGATTCAAACAATAAAAAAGATAAGTCTAACAGCAGTTTA
GTTTAGCCTGTTTTTATTTCTAAAGATTCTCCTTAGACAAGCCAACGTTAAAATAGTGAC
TAAAAAATAAAATTATAAGGAAAAAATAAGAATTAAGCTGATAAAAAAGGTATTTCAGAT
TTTTTATTCAACGACTAAAATGTTTACTCATCAGATTCATCTTCTCTTTCTGAACTATCG
GCTGATGAATTGCATAATAAAATTAAACAGAACAATTAAAATATAAGTAAAAGTCATTAA
TTCTAGATGAATGAATAAAAAAAATAGTCTAACAATCATTAATTCACCTCATAATTTGCA
TAGATAAGACTTAAAAAAAAAAAAAATAGTGAAGACTCAATAGACACACCTAGTTTGTAA
GAACTTGATTAAGAGCTTGTTATATAAGGGAAAAAAACATAACCGACAATTTATAAGCAT
AAAGATTAGATAAAGCTAGCTTAAAAAGTGAGTACAGATGAAAAAGCTACTTAACCATAG
CAATTAATTAAATAACATACAAAAAATAAAATAATTCTAAACTCAAATGAAAATAAGAAA
TTTGTTTTTGAAAATATAGTTATATCAAAAAGAGGTTCACAGCTATCCTAATATAATGGA
TAGAAACCACTAAATGATGCTTAAAGCTAAGAATTAAAATAAAACGAGAGAATTAATTTA
GCTGATGATTCAGACGAAAGTATTTTACAAGTCTAAAGCAGCTAAAGGTAAAACAAATCA
AATAAGTAGATCATAATTTCATCTTAAAGCTTAAATGATGGAGAAAGAAACGAAGTAATT
CAATCGTAAAGCAAAGAAAGATAGGATTCTTTAGAAAAGAAAAATGAAGAGAACGAAATC
CACCCAAGAGGTAGACATAAACACTAATTTTTATTTAAAAGAAGAAGTTAATCTGCAACT
AAGACAAATATTTAAGAATTCAATTTGAATAAAACGTAAAGAAGGTCGCTAATTTTTGAT
GACGAAAAATCTGTTTAAGAAACATAAAATATTGAATAACAAAATTTAATTCAAAAAAAT
CAATTTAAAATATCTGTAAAACACCAAAATGGATAAACAATATAAAAATCCAAAAAGGGG
AATATCCATTTAGAGAGTTTAGAATAGAAAAACAATTAAGAAAATTAAAAAAGAAAAATC
AGTAACTTGTCTAATGGTAGAGGCTAGAATTTAATATCTTAGCAAGAAAAGAACTTGGCA
AAAAAGATAAATATGCCTTTATTGAATCCAAATGAGTAGTTTACTATAAAGTAGAAAAAG
AGAATTAATGTTGATCCTTTGTCACTTTTAAATCAATACCAACAATTTTCCAAATAAGAA
AATGAAAAATTAATAGAATAAATAAAAGCAATTTTAAGCAAAAATAATAACTTTTAGAGC
TAGAATGCAACACCTGTTGCAAAATAAATAAAAAAATTAAATTCAATTGATTAAAATAAT
GTTTAAAAGTAAAATTTAGAGAGCAAATCATCCAATAATCTGAACAAATTGTAAAGTATA
GAAGAATACCCATAACCCATTTCTGAGGTTGAACTAAATGATAAGATGATTTATAAAATT
AAAACTAACTTAAATTACAGTAGTGATTTATTCTAATATGATTTTGACTCAATGAAAATT
TTTAAATACTATTTTCCACATAATAATTACTCTAATGTTGTTTCTCGCCTCAAACCAAAA
AAATTAAAAAACGCAAATAGAAACACAATTAAACGCAGAACAGTCATAAATTCTTAAAAT
TTCAATAACCAATAAAATATTTGA


>TTHERM_00310490(protein)
MNYENQGRSSKIQQRIQVPNIQLNEQDQHVFDTDGMISSQGDWSSPIKINQDTPNQFMQE
TQQNLITSNDDNLDAISKKSSSKNNNNNIDSDMDYLKKVNLNLQKSKSQIEKQGTKEEDS
GKNHKISKHSQSNASIAPSFVLDQQQEDQQADQTQKHLIQTNQNFNEQSKTQKNVFDDEN
PQRRLREYRRTQYRNVSLKLLENGTNAQAQEANWNTQTNLDIEGFSPTLTLNNINKSKKS
FLALNVNECSTPQNNPNKIKVYPLLSSGVSTDNLRKSQIINRVSQHSINLDKNGTFNQYL
DFNKDRPLSKGDQLLGFSAFEGQNQSQQPSLINGMNIQAYYSFQGRTGENDSQAHYNQNA
SNQVMLSQNQQYQSIAHSQFYAAPLQTNNNNINNIRNPSESNINWNIAIKIKNISRFISK
VRSQTSDFNKKNLKDFHHKLINDASDSKIYAQSGSNNTLPSLNTSQKIQLQQSNTLVRED
SQEQNCLEKVFYKMMNILFKRCLYYLDNIITSEKSYVFSPEQTMIVFWNILFGLLLLFQF
FYIPFSVGFDVDIVDQTKYRLLFYIIPIIACFIDSLINLNLGYYLQGLVEIDRLKIIKRY
IKQFLIRDIISLFSLIMTLQTNVSYYSLLFFVRIPQLFKILEEHAEYFQLEQKYYNYYQL
GNLLFMIFYISHICGCIFHYISYEIGVQSQNDLKDTWLNDAGVFYSSIFKRYVYSFYFIV
ITITTVGYGDIKPISVYEKIYVTIITILGSCIFAYTVNTVGTIFQEIERKKAQSKQRKYE
LTSYLNQRQVKKDIQIRVLKHLEFNQQREDDDPIRGMNILESVSKNLKEEVCKDFYGRIL
QQSKIFNLQFSQQALLDASLQFKEKILSPGEIVFKEGQANDHDIFYIYKGSIDLFVQKSR
KQQRTIFTAKSGMFFGQGGFFSSAPRECSAKTITVCHLLVLSQSDFIKTLKNHTEDYEKF
CVIKDEMNIYKIQQHMTCFSCGQFNHTLLNCHLIHYKRNRDLFLARYRYSIPQERKKEII
RKNYGKSSSWKQRQVVRQSLFQLRLDALNLILQNPQEITDKQFFNGVNKIKYENGFFFAD
YEEDEELEKLKKEGQEDEDKSSESSSSDEENLQNKLSNLSAASNISNASQLTYNQDDSYR
FGNNVPHFFIQNESADIKAEETLLNSIKEVNELDEENHENKYQSQKRKTSQNLYKYSIQS
QNSRRPHAQSIDDDNHLYHFHKQQTHKESSTSSARKIQSQRSLQLVTYSKRSELLEIANQ
NSLKTSHDSNNKKDKSNSSLVQPVFISKDSPQTSQRQNSDQKIKLQGKNKNQADKKGISD
FLFNDQNVYSSDSSSLSELSADELHNKIKQNNQNISKSHQFQMNEQKKQSNNHQFTSQFA
QIRLKKKKNSEDSIDTPSLQELDQELVIQGKKTQPTIYKHKDQIKLAQKVSTDEKATQPQ
QLIKQHTKNKIILNSNENKKFVFENIVISKRGSQLSQYNGQKPLNDAQSQELKQNERINL
ADDSDESILQVQSSQRQNKSNKQIIISSQSLNDGERNEVIQSQSKERQDSLEKKNEENEI
HPRGRHKHQFLFKRRSQSATKTNIQEFNLNKTQRRSLIFDDEKSVQETQNIEQQNLIQKN
QFKISVKHQNGQTIQKSKKGNIHLESLEQKNNQENQKRKISNLSNGRGQNLISQQEKNLA
KKINMPLLNPNEQFTIKQKKRINVDPLSLLNQYQQFSKQENEKLIEQIKAILSKNNNFQS
QNATPVAKQIKKLNSIDQNNVQKQNLESKSSNNLNKLQSIEEYPQPISEVELNDKMIYKI
KTNLNYSSDLFQYDFDSMKIFKYYFPHNNYSNVVSRLKPKKLKNANRNTIKRRTVINSQN
FNNQQNI


>TTHERM_00310490(gene)
ATGAATTATGAAAATTAAGGTCGAAGCTCAAAAATATAACAAAGGATTTAAGTTCCTAAC
ATATAGCTTAATGAATAGGATTAGCATGTTTTTGATACTGATGGAATGATCTCGTCTCAG
GGAGATTGGAGTTCTCCTATAAAAATTAACCAAGATACACCAAATTAGTTCATGTAGGAA
ACATAATAGAATTTGATTACTTCAAATGATGATAATTTAGATGCTATTTCAAAAAAAAGT
AGTAGCAAAAACAACAACAACAATATCGATAGTGATATGGATTACTTAAAAAAAGTAAAT
TTAAATCTGTAAAAAAGCAAATCATAAATAGAAAAATAGGGCACAAAGGAAGAAGATTCA
GGAAAAAATCATAAAATTAGCAAGCATAGTTAAAGTAATGCTTCAATAGCACCAAGTTTT
GTATTAGATTAGTAATAGGAAGATTAATAGGCTGATTAAACTTAGAAGCATTTAATTCAA
ACTAACTAAAATTTTAATGAGCAATCAAAAACACAAAAGAATGTATTCGATGATGAAAAT
CCTCAAAGAAGATTAAGAGAATATAGAAGAACTTAATACAGAAATGTTTCTCTAAAACTT
CTTGAAAACGGAACAAACGCATAAGCTTAAGAAGCAAATTGGAATACTCAAACTAATTTA
GATATAGAAGGATTTTCACCAACATTAACATTAAATAACATTAACAAATCAAAGAAAAGT
TTTTTGGCTTTAAATGTAAACGAATGTTCCACTCCACAGAACAATCCAAACAAAATAAAA
GTTTATCCTCTTTTATCTAGTGGGGTAAGCACTGACAACTTGAGGAAGAGTTAAATAATA
AATAGAGTTTCCTAACACAGCATTAATTTAGATAAAAATGGAACTTTTAATCAATATTTA
GATTTTAATAAGGACAGACCTTTAAGCAAAGGGGATTAACTTCTCGGATTTAGCGCTTTT
GAGGGTTAAAATTAATCTCAATAACCTTCTCTAATAAATGGAATGAATATTTAAGCTTAT
TATTCATTTTAAGGGCGTACAGGAGAAAACGATTCATAAGCTCATTACAATTAAAATGCT
TCTAATTAAGTTATGCTTTCACAAAATTAGCAATATTAATCTATTGCACACAGTTAATTC
TATGCAGCTCCTTTATAAACTAATAACAACAACATAAACAATATAAGAAATCCAAGTGAG
TCTAATATAAATTGGAACATAGCTATTAAGATAAAGAATATTAGTAGATTTATTTCTAAA
GTAAGAAGCCAAACAAGTGATTTCAATAAGAAAAACTTAAAGGATTTTCACCATAAGCTG
ATTAATGATGCTTCAGATAGTAAAATATATGCTCAGAGTGGTAGTAATAATACATTACCC
TCATTGAATACTAGTCAAAAAATATAACTCCAATAATCTAATACTCTAGTGAGAGAAGAC
TCTTAAGAATAAAATTGTTTAGAGAAAGTTTTCTACAAAATGATGAATATTTTATTTAAA
AGATGTTTATATTACCTAGATAATATAATAACAAGTGAAAAATCATATGTTTTCTCCCCT
GAACAGACAATGATCGTCTTTTGGAATATTTTGTTTGGTTTACTATTGTTATTTTAGTTT
TTTTATATACCATTCTCAGTAGGTTTTGATGTGGATATAGTTGATTAAACTAAATACAGA
TTGCTATTCTACATTATTCCCATAATAGCATGCTTTATAGACTCTTTGATCAATCTAAAT
CTAGGATATTACCTGCAAGGTTTAGTAGAAATAGATAGATTAAAAATCATCAAAAGGTAT
ATAAAATAATTTCTGATAAGAGATATTATAAGCTTATTTTCTTTGATAATGACTTTATAG
ACAAATGTAAGTTATTATTCTTTGCTGTTTTTTGTTCGAATTCCTCAACTTTTCAAAATA
CTTGAAGAACATGCTGAATATTTTTAGTTAGAACAAAAATATTATAACTATTACTAATTG
GGAAATTTACTTTTTATGATATTTTACATTTCTCACATATGTGGTTGTATATTTCATTAT
ATCTCCTATGAAATTGGTGTTCAATCTTAGAATGATTTAAAGGATACATGGCTGAATGAT
GCAGGAGTTTTTTACAGTTCAATATTCAAAAGATATGTTTATTCGTTTTACTTTATAGTT
ATTACAATCACTACAGTTGGCTACGGTGATATAAAACCAATATCTGTATATGAAAAAATA
TACGTCACTATCATAACTATACTAGGTTCTTGTATATTTGCATATACAGTTAACACTGTT
GGAACAATATTCTAGGAAATTGAACGCAAAAAAGCTTAATCAAAGTAACTATTTTAAATT
AACTAAATATTATTTGAATTTTTCAATTTGATTTCATATTATTTTCAATATTTTTGTTAA
TAAAAATGGTCATTTAAAGTTGTAAATTATTTAATACATTTTTTATTTTATGATATTATA
AAAGATAAAGAAAATATGAATTAACTAGCTACTTAAACTAGAGGTAGGTAAAAAAGGATA
TTCAAATCAGAGTATTAAAACATTTAGAGTTTAATTAGTAAAGAGAAGATGATGACCCAA
TTAGAGGAATGAATATACTTGAAAGTGTATCTAAAAACTTAAAAGAAGAGGTTTGTAAGG
ATTTTTATGGAAGAATATTATAATAGAGCAAAATATTTAACTTATAATTCTCATAGCAAG
CACTTTTAGATGCTTCTTTGTAATTTAAAGAAAAAATTTTGAGCCCAGGTGAAATAGTTT
TTAAAGAAGGCTAAGCTAATGATCATGACATCTTTTATATCTATAAGGGTAGCATAGATC
TTTTCGTTTAAAAATCAAGAAAGTAGTAGAGAACTATTTTTACAGCCAAAGTAATTAATT
CACTTTTAATATCTCCCATCATTTATTAAATTATTTTTTAATAATTATATTATATCTAAG
AGTGGCATGTTTTTTGGACAAGGAGGTTTTTTTAGTTCTGCTCCCAGAGAATGCTCTGCC
AAGACTATTACAGTGTGTCATTTACTTGTTTTAAGCTAGAGTGATTTCATAAAGACTCTC
AAGAATCACACCGAAGATTATGTAATCAGAATTAAAATGCTTTTTAATTTGTTGTACTTA
AAAAATATTTTTATAAAAAGGAAAAATTTTGTGTCATAAAAGATGAAATGAATATTTATA
AAATTTAATAGCACATGACATGCTTTAGCTGTGGATAGTTTAACCATACTTTACTGAACT
GCCACTTAATCCATTATAAAAGAAACAGAGATCTATTTCTAGCACGCTACAGATATAGTA
TCCCATAGGAAAGAAAAAAAGAAATAATACGTAAAAATTATGGAAAATCTTCATCTTGGA
AATAAAGGTAGGTTGTGAGGTAGTCACTTTTTTAGCTCAGACTTGACGCACTCAATTTAA
TACTATAGAACCCATAAGAAATAACAGACAAACAATTTTTTAATGGAGTAAATAAGATCA
AATATGAAAATGGATTTTTCTTCGCTGATTATGAAGAAGATGAAGAATTGGAAAAATTAA
AAAAGGAAGGTAATTAATTAATTTATGGTTTTTTTTAGAATTTGCAAAATCTTAACAATA
ATTTTGTTAAAAATAAGGGTAAGAAGATGAAGACAAATCTAGTGAATCTTCTTCAAGTGA
TGAAGAAAATTTATAGAATAAATTAAGCAATTTAAGTGCAGCTAGTAATATTAGTAATGC
TAGTTAGTTAACTTACAATCAAGATGATAGCTATAGATTTGGTAATAATGTACCACATTT
TTTTATTCAAAACGAAAGCGCTGATATAAAGGCTGAGGAAACTTTATTAAACTCGATCAA
AGAAGTGAACGAATTAGATGAAGAAAATCACGAAAATAAATATCAATCATAAAAAAGAAA
AACATCTTAAAATCTTTATAAGTATTCTATTTAATCTTAAAATAGTAGAAGACCTCATGC
TTAATCAATTGATGATGATAACCATTTATATCATTTTCATAAATAATAAACTCATAAAGA
AAGTAGTACTTCATCTGCAAGAAAAATTTAATCTTAGAGATCGTTGTAATTAGTAACATA
TTCTAAAAGATCTGAGCTATTAGAAATTGCAAATCAAAATTCCTTAAAAACATCTCATGA
TTCAAACAATAAAAAAGATAAGTCTAACAGCAGTTTAGTTTAGCCTGTTTTTATTTCTAA
AGATTCTCCTTAGACAAGCCAACGTTAAAATAGTGACTAAAAAATAAAATTATAAGGAAA
AAATAAGAATTAAGCTGATAAAAAAGGTATTTCAGATTTTTTATTCAACGACTAAAATGT
TTACTCATCAGATTCATCTTCTCTTTCTGAACTATCGGCTGATGAATTGCATAATAAAAT
TAAACAGAACAATTAAAATATAAGTAAAAGTCATTAATTCTAGATGAATGAATAAAAAAA
ATAGTCTAACAATCATTAATTCACCTCATAATTTGCATAGATAAGACTTAAAAAAAAAAA
AAATAGTGAAGACTCAATAGACACACCTAGTTTGTAAGAACTTGATTAAGAGCTTGTTAT
ATAAGGGAAAAAAACATAACCGACAATTTATAAGCATAAAGATTAGATAAAGCTAGCTTA
AAAAGTGAGTACAGATGAAAAAGCTACTTAACCATAGCAATTAATTAAATAACATACAAA
AAATAAAATAATTCTAAACTCAAATGAAAATAAGAAATTTGTTTTTGAAAATATAGTTAT
ATCAAAAAGAGGTTCACAGCTATCCTAATATAATGGATAGAAACCACTAAATGATGCTTA
AAGCTAAGAATTAAAATAAAACGAGAGAATTAATTTAGCTGATGATTCAGACGAAAGTAT
TTTACAAGTCTAAAGCAGCTAAAGGTAAAACAAATCAAATAAGTAGATCATAATTTCATC
TTAAAGCTTAAATGATGGAGAAAGAAACGAAGTAATTCAATCGTAAAGCAAAGAAAGATA
GGATTCTTTAGAAAAGAAAAATGAAGAGAACGAAATCCACCCAAGAGGTAGACATAAACA
CTAATTTTTATTTAAAAGAAGAAGTTAATCTGCAACTAAGACAAATATTTAAGAATTCAA
TTTGAATAAAACGTAAAGAAGGTCGCTAATTTTTGATGACGAAAAATCTGTTTAAGAAAC
ATAAAATATTGAATAACAAAATTTAATTCAAAAAAATCAATTTAAAATATCTGTAAAACA
CCAAAATGGATAAACAATATAAAAATCCAAAAAGGGGAATATCCATTTAGAGAGTTTAGA
ATAGAAAAACAATTAAGAAAATTAAAAAAGAAAAATCAGTAACTTGTCTAATGGTAGAGG
CTAGAATTTAATATCTTAGCAAGAAAAGAACTTGGCAAAAAAGATAAATATGCCTTTATT
GAATCCAAATGAGTAGTTTACTATAAAGTAGAAAAAGAGAATTAATGTTGATCCTTTGTC
ACTTTTAAATCAATACCAACAATTTTCCAAATAAGAAAATGAAAAATTAATAGAATAAAT
AAAAGCAATTTTAAGCAAAAATAATAACTTTTAGAGCTAGAATGCAACACCTGTTGCAAA
ATAAATAAAAAAATTAAATTCAATTGATTAAAATAATGTTTAAAAGTAAAATTTAGAGAG
CAAATCATCCAATAATCTGAACAAATTGTAAAGTATAGAAGAATACCCATAACCCATTTC
TGAGGTTGAACTAAATGATAAGATGATTTATAAAATTAAAACTAACTTAAATTACAGTAG
TGATTTATTCTAATATGATTTTGACTCAATGAAAATTTTTAAATACTATTTTCCACATAA
TAATTACTCTAATGTTGTTTCTCGCCTCAAACCAAAAAAATTAAAAAACGCAAATAGAAA
CACAATTAAACGCAGAACAGTCATAAATTCTTAAAATTTCAATAACCAATAAAATATTTG
A