Identifiers and Description

Gene Model Identifier

TTHERM_00305590

Standard Name

None

Aliases

PreTt21260 | 29.m00221 | 3696.m00043

Description

methyltransferase, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00537 ) methylase, putative
  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( PF05175 ) methyltransferase small domain
  • ( TIGR02072 ) biotin biosynthesis protein BioC
  • ( PF01209 ) methyltransferase, UbiE/COQ5 family
  • ( PF02353 ) Cyclopropane-fatty-acyl-phospholipid synthase
  • ( TIGR01983 ) 3-demethylubiquinone-9 3-O-methyltransferase
  • ( TIGR01934 ) ubiquinone/menaquinone biosynthesis methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00305590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11621.19.997093137033517e-262methyltransferase (288 aa)
DictyBaseDDB_G02697224.0008598455422075e-100DDB_G0269722 on chromosome: 1
position 3414230 to 3415170
OxytrichaContig16595.0.g438.003693242657371e-87Methyltransferase involved in
Williams-Beuren syndrome
WormBaseWBGene000161663.998052787723392e-80status:Confirmed UniProt:Q18
257 protein_id:CCD65741.1
SGDYCR047C2.998830401637127e-79BUD23 Methyltransferase, methy
lates residue G1575 of 18S rRN
A; required for rRNA processin
g and nuclear export of 40S ri
bosomal subunits independently
of methylation activity; dipl
oid mutant displays random bud
ding pattern
Stentor CoeruleusSteCoe_210001.0112214926104486e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00305590(coding)
ATGGCAACAAGACCTGAAAATATATGTCCTCCTGAAATATACTATAATCAGGATGAAGCT
GTTAAGTATACTAATTCTACAAGAATTATTGAAATTCAAGAATAATTAACTGAAAGATGC
ATTGAATTATTAAATATACCTGAAGGCGAGGATTAATTAATCCTTGATATTGGATGTGGA
AGTGGATTATCTGGAGCTTAGTTAAGTGAGCACAATCATCACTGGGTTGGTATTGATATT
TCAAGAGATATGTTAAATGTAGCAGTAGAAAGAGAGAGCGAAGGAGATCTCTATGAAATA
GATATGGGATAAGGATTTAATTTCCGTCATGGTGTTTTTGATTCTGCAATTTCCGTTTCT
GCTTTATAATGGTTATGTGTAGCATCTAAAAAGTCATACAATCCTGTTGCTCGTCTTAAA
AAATTCTTTTAAAGCTTATATAATAGTTTGCGTGCAGGTGGAAAAGCTGTATTATAATTT
TATCCTGATGGAGCCTAATAACTAGAAATGATTACAACTGCTGCTATGAAGTGTGGTTTT
GGAGGTGGTGTAGTCGTTGACTATCCCAACTCTGCTAAGGCCAAGAAACTCTACTTAGTC
ATTTAAGCTGGTGGTGATACAAGAGAATAAAATATAGTAATGATAAACGGATTAGAAGAC
GAAAACGAAGAAGAAGCCAAATTCAATGCAGCTCAAAAGTAAAAGTAAATTCATAAAGCT
AAAAAGCCAAAAATAAAGAGCAAAGAATGGATTTAAAATAAGAAGGAAAGACAAAGAGCA
TAAGGAAGAGAAGTAAGACCAGATAGTAAATATACCGGAAGAAAGAGATCAGGTCCTTCC
AAGTACTTAAAATGA


>TTHERM_00305590(protein)
MATRPENICPPEIYYNQDEAVKYTNSTRIIEIQEQLTERCIELLNIPEGEDQLILDIGCG
SGLSGAQLSEHNHHWVGIDISRDMLNVAVERESEGDLYEIDMGQGFNFRHGVFDSAISVS
ALQWLCVASKKSYNPVARLKKFFQSLYNSLRAGGKAVLQFYPDGAQQLEMITTAAMKCGF
GGGVVVDYPNSAKAKKLYLVIQAGGDTREQNIVMINGLEDENEEEAKFNAAQKQKQIHKA
KKPKIKSKEWIQNKKERQRAQGREVRPDSKYTGRKRSGPSKYLK


>TTHERM_00305590(gene)
ATGGCAACAAGACCTGAAAATATATGTCCTCCTGAAATAGTAATTAGCTATTAATTAGAT
TAAAATTAAGTTTCATCATGAGTTTTACTCTCATAGCTGATAATTTCATGTGATAAATAC
ATTTTTTTGTAAAAATTAAAGTACTATAATCAGGATGAAGCTGTTAAGTATACTAATTCT
ACAAGAATTATTGAAATTCAAGAATAATTAACTGGTAAAATAGTTTTATAAATTTAAATA
AGCATCAAATAATTTGGAAATTTTTGCTTTAAATACTCAACTTAAAAGCATTTAAAAAGC
CTATAAGGTGAATTTAGCTGATTGAAGTTTTAAATTAGAATGATGCGAATTTAATATAAT
TTAGAGATTTTGCTAAAAATATTTCATTAAATAAAGAAAGATGCATTGAATTATTAAATA
TACCTGAAGGCGAGGATTAATTAATCCTTGATATTGGATGTGGAAGTGGATTATCTGGAG
CTTAGTTAAGTGAGCACAATCATCACTGGGTTGGTATTGATATTTCAAGAGATATGTTAA
ATGTAGCAGTAGAAAGAGAGAGCGAAGGAGATCTCTATGAAATAGATATGGGATAAGGAT
TTAATTTCCGTCATGGTGTTTTTGATTCTGCAATTTCCGTTTCTGCTTTATAATGGTTAT
GTGTAGCATCTAAAAAGTCATACAATCCTGTTGCTCGTCTTAAAAAATTCTTTTAAAGCT
TATATAATAGTTTGCGTGCAGGTGGAAAAGCTGTATTATAATTTTATCCTGATGGAGCCT
AATAACTAGAAATGATTACAACTGCTGCTATGAAGTGTGGTTTTGGAGGTGGTGTAGTCG
TTGACTATCCCAACTCTGCTAAGGCCAAGAAACTCTACTTAGTCATTTAAGCTGGTGGTG
ATACAAGAGAATAAAATATAGTAATGATAAACGGATTAGAAGACGAAAACGAAGAAGAAG
CCAAATTCAATGCAGCTCAAAAGTATTATTCTTATCAATCATTAGAAGACTGTATTTACA
TAATATTAAAGCTATTTTATAATATTTTTTAATTCAAAACTTTAATGCATAAACTACAGC
TTCTGCTAATAATTTTTGCATTATAATTAAATTTGTTTCTTTTGCATTTAATTTCTTAGG
TAAAAGTAAATTCATAAAGCTAAAAAGCCAAAAATAAAGAGCAAAGAATGGATTTAAAAT
AAGAAGGAAAGACAAAGAGCATAAGGAAGAGAAGTAAGACCAGATAGTAAATATACCGGA
AGAAAGAGATCAGGTCCTTCCAAGTACTTAAAATGA