Identifiers and Description

Gene Model Identifier

TTHERM_00304190

Standard Name

None

Aliases

PreTt21225 | 29.m00186 | 3696.m00009

Description

cyclic nucleotide-binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00027 ) cyclic nucleotide-binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00304190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11578.19.997093137033517e-262cyclic nucleotide-binding doma
in-containing protein (887 aa)
OxytrichaContig6706.0.g193.9990760533890984e-36Cyclic nucleotide-binding doma
in
Stentor CoeruleusSteCoe_88416.305116760146989e-16
SGDYIL033C0.00000005001214305021125BCY1 Regulatory subunit of the
cyclic AMP-dependent protein
kinase (PKA), a component of a
signaling pathway that contro
ls a variety of cellular proce
sses, including metabolism, ce
ll cycle, stress response, sta
tionary phase, and sporulation
WormBaseWBGene000021900.00007000107212225429locus:kin-2 cAMP-dependent p
rotein kinase regulatory subun
it status:Partially_confirme
d UniProt:P30625 protein_i
d:CCD67513.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00304190(coding)
ATGAGCTAGCAGCCTAATCCTACTGATAAAAAATAGCTTGATATGAAATAAGTAACAAGA
ATACTTAAAACACCTAGTGAGTCTAGAACATTAAAATAATGCACTGAACTCTTAGAGATA
GTTGGCGATTTACAATTTTTTAAGGAGTATAATTCAAATCCTTCAACAGCAAATGTCCCT
AAACTTTGCTGTAAATATATGGAGATTGAAAAATTTAATGAAGCTGATATTGTTTTTGAG
TTTGGATCTGTTGGTAATAAGTTTTACATTGTACTCTAAGGATCAGTAGGAGTTTTTGTA
AAAAAACCTTAAAGTGTCTTAGATAAGGAAAAGGAAGAAAAGAAAGATGATAAGAAGAAG
GAGGCTCAATAAGATGCAGTAGTTGACCCTCTTGCTGATTTTATGTGTGTCAAAGAATTA
GGTGATGGTAGTGCTTTTGGTGAATTAGCCTTACTGAATAATAAGCCAAGACTTGCCACT
ATAAAAACCCTTCGTGAAACTCATGTTGCTACTCTCAGTAAAGAGAATTTTAACAAAATT
CTGAAAGAGCATGAAGAACAAAAGATTATGAAAGAAATTTAATTTTTTGAGAAGGTTCCT
GCTTTCAAAGACTTTAACTAGAAGTAAATCAGATATTTATGTCTAAATAATAAGACACTT
GAAACTCAAAAGAATGAAGTTATTTATGATGAAAAAGATCCTTGCGATTGCATATATGTT
ATTAAAGAAGGGGAATTTGAGGTATACAAATCTGTTGAGAAGCAAGTAGACTAGAAAGAA
GAAATTATGAAATAAAGCATTTTAAGCATGTCTGTCTTAAATAAAAATAGTAGCTAAAAA
ATATCAAAATAAATAAAGATTAAGGTATTGACAACAGGTGAAATTTGTGGAGAGGAATTT
TTTTTAAATAAGAAGCAAAGAGAATTTAAATTAGTTTGCTGTAGCCTTTCAGGAATTATA
GTTAAAATTAAAATCAATGATTTTTTGAGAAAATTAAATGAAGATTCTACAATGTAAAAA
GCTTTTTATAAAAGATTTTAACATATAAATGAAGAATTTTAAGAAAGAGTATAAAAGAGA
ATTTAATAGTTTCATGAATATAAAAACTTTCTTATCCAAGACAGTATCCCAACAAAGATT
AAAATGTCAATCGAAAAGCTGTATCAAAATAATGGGATGTCTTTGGAACAAAAGTAAACC
GAAATTAGTGAATTTCGTCAATAATTAGTAGATATAGAAAACCTTAATAAAAAGAATGAG
TATCAACAAGCAATTCTTTCTCAAATTGCAATCAGTAAGCGCTATAATTAAGCTAATAGT
TTGATGTTTTAAAATTAAGTGCAATATTTAAAATATAAGCGTTTAAATATTTTATCTGAA
AGTATATCTAAAACTCCATCTGCAAGAAACTAAACTCCCCCTGAATTTTAGTAGCAACCA
TAAAAATATGATGATAGAAGGTCCTCCTTCTCAAGTGCTACAAACTAGCTGATGTATGAT
AAAAGATTATAAGAAGCATTACAAAATAAGTAGAATTCGACCCCTTAAAGTAGAAATAAT
ATTCCAAATATGCACAAATCAATGGTTGATTTTGAAGATATGATAAAAACACAAACAAAA
AATTCGAATATTGATTAGAATAGTTAACTCGAGTCTCTTAAGAGTTAAGTACCTACTATA
AGTCCTTAAAGAACAAACAATAAGACTTCTTTAATAAGATAACAAATTTTTAGAAATCAA
GCTGGACATCAATCTTTAGATAACTTTCAGGCTCTTAATAAAAGCAATAGCATTTCTTAA
AATAACAACAATTTATATTAAATAACACCACTGTCAAAAAATCAATCTATAAATGAAGAT
AAAAAATTCAATGATCTTTTGTAATCGCCTAAAAAATAATCAAGAGAATTGAAGCGTGTC
CAAAGCTCTTAATTTTAAAGCTCAAACACATTCTCTAAAAAACAATCCTACTTAGAATAA
ATAAACTAAAATGACTAAGAGAATTCTCCTTCTTCTCAAGGAGGTTTAACTAAAAATAAA
AGTGCTCTTCTTAATAACTCAAAGAATATGTTAAACCAAATCTCAGAATTTGATTCTTAG
AAAGTAGATAACAATCTTTATTAATTTAATGTCCCTAACAAGAGACTTATAAAATATACT
AATCCCTCAAAAGATAATTTTATCAGGGATTGGAAAAAAAATAATCAAGTTTTTGAAGAT
GCATAGTAGTAAAGCTTGATAAGAAAGATTAAAAAAATAACAAATTAAAATGCTAAATTT
AGTGATTATTTTAAATCTTAGATTGGAAAAAGCTTAAATGACTCAATTGGTTAGTAGACT
TAACAGTTGCAATAAAATCCTCAAACTTAAATGCAAAATTTAAATGCTCCCAAATCAGAA
AACACTTCTTCTACTAATACCTCACATTTACCATCTCCATTAATATTGCCAAAAATTTTT
GAATAATCACCTGCTGGTACCTAAAATAATATATAAAACTCTCCAAAGACACATTTTAAT
GCAGGTATTTATTATCAGTCAGAAAACCATGAAAATGCCAAGAAAGTGAATAACTTTTAA
ATTCAAAAATAGATACAATAAAAATTGTAATATTAAAATAACAAAGATGTCAAAGATAAA
AAGAAATCTTTATTGATTGTAAGCTGA


>TTHERM_00304190(protein)
MSQQPNPTDKKQLDMKQVTRILKTPSESRTLKQCTELLEIVGDLQFFKEYNSNPSTANVP
KLCCKYMEIEKFNEADIVFEFGSVGNKFYIVLQGSVGVFVKKPQSVLDKEKEEKKDDKKK
EAQQDAVVDPLADFMCVKELGDGSAFGELALLNNKPRLATIKTLRETHVATLSKENFNKI
LKEHEEQKIMKEIQFFEKVPAFKDFNQKQIRYLCLNNKTLETQKNEVIYDEKDPCDCIYV
IKEGEFEVYKSVEKQVDQKEEIMKQSILSMSVLNKNSSQKISKQIKIKVLTTGEICGEEF
FLNKKQREFKLVCCSLSGIIVKIKINDFLRKLNEDSTMQKAFYKRFQHINEEFQERVQKR
IQQFHEYKNFLIQDSIPTKIKMSIEKLYQNNGMSLEQKQTEISEFRQQLVDIENLNKKNE
YQQAILSQIAISKRYNQANSLMFQNQVQYLKYKRLNILSESISKTPSARNQTPPEFQQQP
QKYDDRRSSFSSATNQLMYDKRLQEALQNKQNSTPQSRNNIPNMHKSMVDFEDMIKTQTK
NSNIDQNSQLESLKSQVPTISPQRTNNKTSLIRQQIFRNQAGHQSLDNFQALNKSNSISQ
NNNNLYQITPLSKNQSINEDKKFNDLLQSPKKQSRELKRVQSSQFQSSNTFSKKQSYLEQ
INQNDQENSPSSQGGLTKNKSALLNNSKNMLNQISEFDSQKVDNNLYQFNVPNKRLIKYT
NPSKDNFIRDWKKNNQVFEDAQQQSLIRKIKKITNQNAKFSDYFKSQIGKSLNDSIGQQT
QQLQQNPQTQMQNLNAPKSENTSSTNTSHLPSPLILPKIFEQSPAGTQNNIQNSPKTHFN
AGIYYQSENHENAKKVNNFQIQKQIQQKLQYQNNKDVKDKKKSLLIVS


>TTHERM_00304190(gene)
AAAAACTTTTTGTTTAAATTAAAATAACTAAAAGAAATAACTAAGAAAGATTTAGAGTCT
TTATATTTATTTATCTATAAAGAAGACATATTATTAATTAGATAAGCAACAAGCCAAAAT
ATATATCGATCAATGAGCTAGCAGCCTAATCCTACTGATAAAAAATAGCTTGATGTAAAA
ATAGTTTAAATAAATTCAAATTTAGCATAGTTATTAATATTTAGATGAAATAAGTAACAA
GAATACTTAAAACACCTAGTGAGTCTAGAACATTAAAATAATGCACTGAACTCTTAGAGA
TAGTTGGCGATTTACAATTTTTTAAGGAGTATAATTCAAATCCTTCAACAGCAAATGTCC
CTAAACTTTGCTGTAAATATATGGAGATTGAAAAATTTAATGAAGCTGATATTGTTTTTG
AGTTTGGTAAATAATTTCTATTCTACAAATTCTTATAAAAATTAACTCACTAATTAAGTG
ATAGTTATTTTATATATGCAATATCTAAATCAAAAAGCAATATATACATATCAATATCTT
TAGCATTATTTTCAAGCATATAAAATATAATTTTTTACACTATTCTATTAGATTATTCTC
TTTCACTAAAGTGATTTTAATCTCCAAAAAAATATTTACAAATGAAAAGAATATAACTCA
TATTTAAATTATAAAATTGTTATAGGATCTGTTGGTAATAAGTTTTACATTGTACTCTAA
GGATCAGTAGGAGTTTTTGTAAAAAAACCTTAAAGTGTCTTAGATAAGGAAAAGGAAGAA
AAGAAAGATGATAAGAAGAAGGAGGCTCAATAAGATGCAGTAGTTGACCCTCTTGCTGAT
TTTATGTGTGTCAAAGAATTAGGTGATGGTAGTGCTTTTGGTGAATTAGCCTTACTGAAT
AATAAGCCAAGACTTGCCACTATAAAAACCCTTCGTGAAACTCATGTTGCTACTCTCAGT
AAAGAGAATTTTAACAAAATTCTGAAAGAGCATGAAGAACAAAAGATTATGAAAGGTATT
TTCAAGCTACTTTAGCTATTAAATTTGATTAAGATAAATTTTTTATAAAATATTTTTTTT
AATAATTAGAAATTTAATTTTTTGAGAAGGTTCCTGCTTTCAAAGACTTTAACTAGAAGT
AAATCAGATATTTATGTCTAAATAATAAGACACTTGAAACTCAAAAGAATGAAGTTATTT
ATGATGAAAAAGATCCTTGCGATTGCATATATGTTATTAAAGAAGGGGAATTTGAGGTAA
GCATGATTTAAATTGAAATTTATAATTTTGCTTAGGTAATAAGCTTGAATGTATTTATTT
CGTTCGCAATTTTATTGTTACTATAGAATTAATTAAAAGATTACAAAATACTATAAAAAT
ATTGGAGACTTAAGCAAAAACTATTACCTTTTTTTTATAGTACTATACCTTATTAATTCA
AAATCATATAACGCTATTAAGTTTAAATTGGTTCATCATCAAACATTAAAAGACTAAATT
AATTTAAAAAAAGAAAGATATAAAAAAAATCTATGATTGAATTAATGAAAATTTTAGTTT
TAAATTTTTTTACATTTGGATTCTAATATATTTTTTAAATTTTTAGGTATACAAATCTGT
TGAGAAGCAAGTAGACTAGAAAGAAGAAATTATGAAATAAAGCATTTTAAGCATGTCTGT
CTTAAATAAAAATAGTAGCTAAAAAATATCAAAATAAATAAAGGTAATTAATAAATTAAT
TTGTCAATAATTATTATTAATTTACTAGCTAACATTTGTTTGTTAATTATACGTTAATTT
AATTTTTTTATTATTACCAATTTTATACTTACTCTAAATTTAATTAAAAATAGATTAAGG
TATTGACAACAGGTGAAATTTGTGGAGAGGAATTTTTTTTAAATAAGAAGCAAAGAGAAT
TTAAATTAGTTTGCTGTAGCCTTTCAGGAATTATAGTTAAAATTAAAATCAATGATTTTT
TGAGAAAATTAAATGAAGATTCTACAATGTAAAAAGCTTTTTATAAAAGATTTTAACATA
TAAATGAAGAATTTTAAGAAAGAGTATAAAAGAGAATTTAATAGTTTCATGAATATAAAA
ACTTTCTTATCCAAGACAGTATCCCAACAAAGATTAAAATGTCAATCGAAAAGCTGTATC
AAAATAATGGGATGTCTTTGGAACAAAAGTAAACCGAAATTAGTGAATTTCGTCAATAAT
TAGTAGATATAGAAAACCTTAATAAAAAGAATGAGTATCAACAAGCAATTCTTTCTCAAA
TTGCAATCAGTAAGCGCTATAATTAAGCTAATAGTTTGATGTTTTAAAATTAAGTGCAAT
ATTTAAAATATAAGCGTTTAAATATTTTATCTGAAAGTATATCTAAAACTCCATCTGCAA
GAAACTAAACTCCCCCTGAATTTTAGTAGCAACCATAAAAATATGATGATAGAAGGTCCT
CCTTCTCAAGTGCTACAAACTAGCTGATGTATGATAAAAGATTATAAGAAGCATTACAAA
ATAAGTAGAATTCGACCCCTTAAAGTAGAAATAATATTCCAAATATGCACAAATCAATGG
TTGATTTTGAAGATATGATAAAAACACAAACAAAAAATTCGAATATTGATTAGAATAGTT
AACTCGAGTCTCTTAAGAGTTAAGTACCTACTATAAGTCCTTAAAGAACAAACAATAAGA
CTTCTTTAATAAGATAACAAATTTTTAGAAATCAAGCTGGACATCAATCTTTAGATAACT
TTCAGGCTCTTAATAAAAGCAATAGCATTTCTTAAAATAACAACAATTTATATTAAATAA
CACCACTGTCAAAAAATCAATCTATAAATGAAGATAAAAAATTCAATGATCTTTTGTAAT
CGCCTAAAAAATAATCAAGAGAATTGAAGCGTGTCCAAAGCTCTTAATTTTAAAGCTCAA
ACACATTCTCTAAAAAACAATCCTACTTAGAATAAATAAACTAAAATGACTAAGAGAATT
CTCCTTCTTCTCAAGGAGGTTTAACTAAAAATAAAAGTGCTCTTCTTAATAACTCAAAGA
ATATGTTAAACCAAATCTCAGAATTTGATTCTTAGAAAGTAGATAACAATCTTTATTAAT
TTAATGTCCCTAACAAGAGACTTATAAAATATACTAATCCCTCAAAAGATAATTTTATCA
GGGATTGGAAAAAAAATAATCAAGTTTTTGAAGATGCATAGTAGTAAAGCTTGATAAGAA
AGATTAAAAAAATAACAAATTAAAATGCTAAATTTAGTGATTATTTTAAATCTTAGATTG
GAAAAAGCTTAAATGACTCAATTGGTTAGTAGACTTAACAGTTGCAATAAAATCCTCAAA
CTTAAATGCAAAATTTAAATGCTCCCAAATCAGAAAACACTTCTTCTACTAATACCTCAC
ATTTACCATCTCCATTAATATTGCCAAAAATTTTTGAATAATCACCTGCTGGTACCTAAA
ATAATATATAAAACTCTCCAAAGACACATTTTAATGCAGGTATTTATTATCAGTCAGAAA
ACCATGAAAATGCCAAGAAAGTGAATAACTTTTAAATTCAAAAATAGATACAATAAAAAT
TGTAATATTAAAATAACAAAGATGTCAAAGATAAAAAGAAATCTTTATTGATTGTAAGCT
GA