Identifiers and Description

Gene Model Identifier

TTHERM_00302100

Standard Name

None

Aliases

PreTt19402 | 28.m00361 | 3691.m00178

Description

aminotransferase, classes I and II family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01264 ) tyrosine aminotransferase
  • ( PF00155 ) aminotransferase, classes I and II
  • ( TIGR01141 ) histidinol-phosphate transaminase
  • ( TIGR01265 ) tyrosine/nicotianamine aminotransferases

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07738.19.99709313703352e-262aminotransferase, classes ...
OxytrichaContig22271.0.g739.99689462303885e-156Aminotransferase class I and I
I
ParameciumDBGSPATP000225900011.0004025422005e-134Paramecium tetraurelia GSPATP0
0022590001 protein
IPI(HUMAN)IPI:IPI00152432.11.0001155149985e-113 EQ:NP_597700|H- INV:HIT000015
824;HIT000019826;HIT000028263|
VEGA:OTTHUMP0 0000080707 Tax_I
d=9606 Alanine aminotransferas
e 2
TAIRAT1G172909.99530525570754e-113alanine aminotransferase, puta
tive
FlyBaseFBgn00304789.99775161630916e-110
FlyBaseFBgn00304789.99775161630916e-110
DictyBaseDDB01867389.99605028384712e-108geneDDB0232139 alanine aminotr
ansferase alanine transaminase
alanine aminotransferase alan
ine transaminase
DictyBaseDDB02321399.99605028384712e-108geneDDB0232139
SGDYLR089C9.9950941977843e-101YLR089C SGDID:S000004079, Chr
XII from 320016-318238, revers
e complement, Uncharacterized
ORF, "Putative alanine transam
inase (glutamic pyruvic transa
minase)"
WormBaseC32F10.8a1.99955410141492e-99WBGene00016333 alanine aminotr
ansferase
ToxoDB55.m050982.00004349420983e-96Toxoplasma gondii aminotransfe
rase, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00302100(coding)
ATGATGCAAAGATAACTAGCTTCAAAATTAGTAAGATTTTTCAACAGTGCTGCTAGCTCT
GCCAACACAGGAGCTCAATACAGATCAGACATGAATAATTAAGGAAAACAAAGAACTGAA
GCTCCCAAATTCATTACTGAAGAAGATATTAACAAGAGAGTTATCAATGCTGAGTACGCC
GTAAGAGGTACTGTACCAACTCGTGCAGGAAAAATAAAATAATTGCTCAAAGAAGGTTCT
CATAACTACCCTTTCAATTAATTAACTGAGTGTAATATTGGTAACCCTCAAATTTTTGGT
TAAAAGCCTATCACTTTTAATAGACAAGTTCTTTCTACTATTTTGAATCCCGAATTAGTT
AATAGTGAAGTCTATAGCAAAGATGTTAGAGCTAGAGCTAAATATTATTTAGAGCGTATG
GGCAGTACTACAATTGGTGCATACTCTGATAGTGCAGGTCATATTTTCATTAGAGAATCT
ATTGCTAAGTACATTGCTAAGAGAGATAACCACCTTATCCCACCAGATGTTAATGATATC
ATCCTCACTGATGGTGCCAGTCAAGGTGTTCAAATTTGCTTAAATGTACTTATTTCTGAT
TCTAGAGATGGTATCATGATTCCTATTCCTCAATATCCACTCTACTCTGCCTCATGTACT
CTTGTAGGAGCTTCAGAAGTTCACTACTTTTTAGATGAATAAAAGGGATGGTCTTGCTCT
GTTGAAGAATTAAAGAAACAACACAGAGACGCTAAAATGCATGGCATCAATCCTAAAATT
CTTGTTGTAATCAACCCTGGTAACCCTACTGGCTAGGTATTAAGCTACGATACCATCAAG
CAAATGATAGAATTTGCTTATGATCATAAGATGGTTATTTTTGCAGATGAAGTCTACTAA
GATAACATCTACACTCCTAACAAGGAATTCGTCAGCTTTAAGAAAGTTCGTTCTGAATTA
CCTTATCCTTATAACAATATTGAGCTATTTTCTTTCCACTCTACTTCTAAGGGTCTTCTT
GGAGAATGTGGTTTGAGAGGAGGTTACTTTGAAATGTGTAACATTGACTCTCGTGTCAAA
GAAGAAATTATTAAGCTCAGATCAATGTTCTTGTGCTCTAACACTGTTGGTTAATGCACT
ACTGAATTAATGTGCAATCCTCCTACACTTTAAAATGCTAGTGCTGAAACTGTAGAGTAA
TATAATAATGAAAGAAATGCTCTTTTGGAATCTCTTAAAAGAAGAGCCCAAATTGTCACT
GAATCATTAAATAAAATGACTAATATAACCTGCCAAGAAGTTGAAGGAGCAATGTATGCA
TTCCCTTCTATTAAGTTCGGTAAAAAAGCCCTTGCTGAAGCTGCTAAAAAGAAAATGGAA
CCTGATCTTTTCTACTGCTTAAATGTTCTTGAAAACACAGGAATAGTCCTTGTTCCTGGT
AGTGGTTTTAGACAAGAAGAAAACACATATCATTTCCGTATAACTACTCTTATCCTTGGA
GAGGATCGTCTTAGAGAATCTATGGAAGCTCTTAAAAATTACAATGAAAAATTCCATAAA
GAATACTGTTGA


>TTHERM_00302100(protein)
MMQRQLASKLVRFFNSAASSANTGAQYRSDMNNQGKQRTEAPKFITEEDINKRVINAEYA
VRGTVPTRAGKIKQLLKEGSHNYPFNQLTECNIGNPQIFGQKPITFNRQVLSTILNPELV
NSEVYSKDVRARAKYYLERMGSTTIGAYSDSAGHIFIRESIAKYIAKRDNHLIPPDVNDI
ILTDGASQGVQICLNVLISDSRDGIMIPIPQYPLYSASCTLVGASEVHYFLDEQKGWSCS
VEELKKQHRDAKMHGINPKILVVINPGNPTGQVLSYDTIKQMIEFAYDHKMVIFADEVYQ
DNIYTPNKEFVSFKKVRSELPYPYNNIELFSFHSTSKGLLGECGLRGGYFEMCNIDSRVK
EEIIKLRSMFLCSNTVGQCTTELMCNPPTLQNASAETVEQYNNERNALLESLKRRAQIVT
ESLNKMTNITCQEVEGAMYAFPSIKFGKKALAEAAKKKMEPDLFYCLNVLENTGIVLVPG
SGFRQEENTYHFRITTLILGEDRLRESMEALKNYNEKFHKEYC


>TTHERM_00302100(gene)
AAAAAATTAAAATTTACAATACTGAATAGAGTTAAAACAAATAAAGAAACATGATGCAAA
GATAACTAGCTTCAAAATTAGTAAGATTTTTCAACAGTGCTGCTAGCTCTGCCAACACAG
GAGCTCAATACAGATCAGACATGAATAATTAAGGAAAACAAAGAACTGAAGCTCCCAAAT
TCATTACTGAAGAAGATATTAACAAGAGAGTTATCAATGCTGAGTACGCCGTAAGAGGTA
CTGTACCAACTCGTGCAGGAAAAATAAAATAATTGCTCAAAGAAGGTTCTCATAACTACC
CTTTCAATTAATTAACTGAGTGTAATATTGGTAACCCTCAAATTTTTGGTTAAAAGCCTA
TCACTTTTAATAGACAAGTTCTTTCTACTATTTTGAATCCCGAATTAGTTAATAGTGAAG
TCTATAGCAAAGATGTTAGAGCTAGAGCTAAATATTATTTAGAGCGTATGGGCAGTACTA
CAATTGGTGCATACTCTGATAGTGCAGGTCATATTTTCATTAGAGAATCTATTGCTAAGT
ACATTGCTAAGAGAGATAACCACCTTATCCCACCAGGTAAATAAAAATATAATTTATAAA
CAACTAAATAAATTATCAAAAAAGAGATAAACAAAATTTGACAAATACCTTTTCAAAACT
AAGCTAACTTATAAAAAGGCATCAAAAATAGAAATTTAAGTTCAATCTCTTTAAATTGCT
GCTATTTTTATAATAGCTCAATATTAAATTAGCTTAAAAAATGACAATTTTCAAGAGTTA
GGATAGCATTTTTTTCCTAATTTAGTTAAATAAAAGCAAAGAGCTTGAAAAGTAAGTTAA
TGAAGCAAATATTATTATTTAATAGATTAATTAAATGCCAAATTAAAAAAAGTAAAAATT
TCTAATTACTTAACAAGCTTGATGAATATTTTAATATTAAAAAATAAAAAAAATAAATTG
ATTCAAACTACTAACTAGCAACTTCAAATTTGAATTATTTCTATCAAATTATAATGATGA
TTTTTTTAAGTAGAGAATAGGATTTATTGAAAAATTAATAATAAAGTATTTGAAATAAAT
TAAATTTTTTTAATTAAAATTAATTTTTAGATGTTAATGATATCATCCTCACTGATGGTG
CCAGTCAAGGTGTTCAAATTTGCTTAAATGTACTTATTTCTGATTCTAGAGATGGTATCA
TGATTCCTATTCCTCAATATCCACTCTACTCTGCCTCATGTACTCTTGTAGGAGCTTCAG
AAGTTCACTACTTTTTAGATGAATAAAAGGGATGGTCTTGCTCTGTTGAAGAATTAAAGA
AACAACACAGAGACGCTAAAATGCATGGCATCAATCCTAAAATTCTTGTTGTAATCAACC
CTGGTAACCCTACTGGCTAGGTATTAAGCTACGATACCATCAAGCAAATGATAGAATTTG
CTTATGATCATAAGATGGTTATTTTTGCAGATGAAGTCTACTAAGATAACATCTACACTC
CTAACAAGGAATTCGTCAGCTTTAAGAAAGTTCGTTCTGAATTACCTTATCCTTATAACA
ATATTGAGCTATTTTCTTTCCACTCTACTTCTAAGGGTCTTCTTGGAGAATGTGGTTTGA
GAGGAGGTTACTTTGAAATGTGTAACATTGACTCTCGTGTCAAAGAAGAAATTATTAAGC
TCAGATCAATGTTCTTGTGCTCTAACACTGTTGGTTAATGCACTACTGAATTAATGTGCA
ATCCTCCTACACTTTAAAATGCTAGTGCTGAAACTGTAGAGTAATATAATAATGAAAGAA
ATGCTCTTTTGGAATCTCTTAAAAGAAGAGCCCAAATTGTCACTGAATCATTAAATAAAA
TGACTAATATAACCTGCCAAGAAGTTGAAGGAGCAATGTATGCATTCCCTTCTATTAAGT
TCGGTAAAAAAGCCCTTGCTGAAGCTGCTAAAAAGAAAATGGAACCTGATCTTTTCTACT
GCTTAAATGTTCTTGAAAACACAGGAATAGTCCTTGTTCCTGGTAGTGGTTTTAGACAAG
AAGAAAACACATATCATTTCCGTATAACTACTCTTATCCTTGGAGAGGATCGTCTTAGAG
AATCTATGGAAGCTCTTAAAAATTACAATGAAAAATTCCATAAAGAATACTGTTGA