Identifiers and Description

Gene Model Identifier

TTHERM_00302100

Standard Name

None

Aliases

PreTt19402 | 28.m00361 | 3691.m00178

Description

aminotransferase, classes I and II family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01264 ) tyrosine aminotransferase
  • ( PF00155 ) aminotransferase, classes I and II
  • ( TIGR01141 ) histidinol-phosphate transaminase
  • ( TIGR01265 ) tyrosine/nicotianamine aminotransferases

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07738.19.997093137033517e-262aminotransferase, classes I an
d II family protein (519 aa)
OxytrichaContig22271.0.g739.996894623038854e-156Aminotransferase class I and I
I
DictyBaseDDB_G02858999.003133173935938e-136DDB_G0285899 on chromosome: 4
position 3800826 to 3802564
SGDYLR089C7.996964956232603e-130ALT1 Alanine transaminase (glu
tamic pyruvic transaminase); i
nvolved in alanine biosyntheti
c and catabolic processes; the
authentic, non-tagged protein
is detected in highly purifie
d mitochondria in high-through
put studies
WormBaseWBGene000163335.999773492405769e-126status:Confirmed UniProt:O01
685 protein_id:CCD61912.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00302100(coding)
ATGATGCAAAGATAACTAGCTTCAAAATTAGTAAGATTTTTCAACAGTGCTGCTAGCTCT
GCCAACACAGGAGCTCAATACAGATCAGACATGAATAATTAAGGAAAACAAAGAACTGAA
GCTCCCAAATTCATTACTGAAGAAGATATTAACAAGAGAGTTATCAATGCTGAGTACGCC
GTAAGAGGTACTGTACCAACTCGTGCAGGAAAAATAAAATAATTGCTCAAAGAAGGTTCT
CATAACTACCCTTTCAATTAATTAACTGAGTGTAATATTGGTAACCCTCAAATTTTTGGT
TAAAAGCCTATCACTTTTAATAGACAAGTTCTTTCTACTATTTTGAATCCCGAATTAGTT
AATAGTGAAGTCTATAGCAAAGATGTTAGAGCTAGAGCTAAATATTATTTAGAGCGTATG
GGCAGTACTACAATTGGTGCATACTCTGATAGTGCAGGTCATATTTTCATTAGAGAATCT
ATTGCTAAGTACATTGCTAAGAGAGATAACCACCTTATCCCACCAGATGTTAATGATATC
ATCCTCACTGATGGTGCCAGTCAAGGTGTTCAAATTTGCTTAAATGTACTTATTTCTGAT
TCTAGAGATGGTATCATGATTCCTATTCCTCAATATCCACTCTACTCTGCCTCATGTACT
CTTGTAGGAGCTTCAGAAGTTCACTACTTTTTAGATGAATAAAAGGGATGGTCTTGCTCT
GTTGAAGAATTAAAGAAACAACACAGAGACGCTAAAATGCATGGCATCAATCCTAAAATT
CTTGTTGTAATCAACCCTGGTAACCCTACTGGCTAGGTATTAAGCTACGATACCATCAAG
CAAATGATAGAATTTGCTTATGATCATAAGATGGTTATTTTTGCAGATGAAGTCTACTAA
GATAACATCTACACTCCTAACAAGGAATTCGTCAGCTTTAAGAAAGTTCGTTCTGAATTA
CCTTATCCTTATAACAATATTGAGCTATTTTCTTTCCACTCTACTTCTAAGGGTCTTCTT
GGAGAATGTGGTTTGAGAGGAGGTTACTTTGAAATGTGTAACATTGACTCTCGTGTCAAA
GAAGAAATTATTAAGCTCAGATCAATGTTCTTGTGCTCTAACACTGTTGGTTAATGCACT
ACTGAATTAATGTGCAATCCTCCTACACTTTAAAATGCTAGTGCTGAAACTGTAGAGTAA
TATAATAATGAAAGAAATGCTCTTTTGGAATCTCTTAAAAGAAGAGCCCAAATTGTCACT
GAATCATTAAATAAAATGACTAATATAACCTGCCAAGAAGTTGAAGGAGCAATGTATGCA
TTCCCTTCTATTAAGTTCGGTAAAAAAGCCCTTGCTGAAGCTGCTAAAAAGAAAATGGAA
CCTGATCTTTTCTACTGCTTAAATGTTCTTGAAAACACAGGAATAGTCCTTGTTCCTGGT
AGTGGTTTTAGACAAGAAGAAAACACATATCATTTCCGTATAACTACTCTTATCCTTGGA
GAGGATCGTCTTAGAGAATCTATGGAAGCTCTTAAAAATTACAATGAAAAATTCCATAAA
GAATACTGTTGA


>TTHERM_00302100(protein)
MMQRQLASKLVRFFNSAASSANTGAQYRSDMNNQGKQRTEAPKFITEEDINKRVINAEYA
VRGTVPTRAGKIKQLLKEGSHNYPFNQLTECNIGNPQIFGQKPITFNRQVLSTILNPELV
NSEVYSKDVRARAKYYLERMGSTTIGAYSDSAGHIFIRESIAKYIAKRDNHLIPPDVNDI
ILTDGASQGVQICLNVLISDSRDGIMIPIPQYPLYSASCTLVGASEVHYFLDEQKGWSCS
VEELKKQHRDAKMHGINPKILVVINPGNPTGQVLSYDTIKQMIEFAYDHKMVIFADEVYQ
DNIYTPNKEFVSFKKVRSELPYPYNNIELFSFHSTSKGLLGECGLRGGYFEMCNIDSRVK
EEIIKLRSMFLCSNTVGQCTTELMCNPPTLQNASAETVEQYNNERNALLESLKRRAQIVT
ESLNKMTNITCQEVEGAMYAFPSIKFGKKALAEAAKKKMEPDLFYCLNVLENTGIVLVPG
SGFRQEENTYHFRITTLILGEDRLRESMEALKNYNEKFHKEYC


>TTHERM_00302100(gene)
AGATATAAATTAAATTAAAAACATTAAAAAATTAAAATTTACAATACTGAATAGAGTTAA
AACAAATAAAGAAACATGATGCAAAGATAACTAGCTTCAAAATTAGTAAGATTTTTCAAC
AGTGCTGCTAGCTCTGCCAACACAGGAGCTCAATACAGATCAGACATGAATAATTAAGGA
AAACAAAGAACTGAAGCTCCCAAATTCATTACTGAAGAAGATATTAACAAGAGAGTTATC
AATGCTGAGTACGCCGTAAGAGGTACTGTACCAACTCGTGCAGGAAAAATAAAATAATTG
CTCAAAGAAGGTTCTCATAACTACCCTTTCAATTAATTAACTGAGTGTAATATTGGTAAC
CCTCAAATTTTTGGTTAAAAGCCTATCACTTTTAATAGACAAGTTCTTTCTACTATTTTG
AATCCCGAATTAGTTAATAGTGAAGTCTATAGCAAAGATGTTAGAGCTAGAGCTAAATAT
TATTTAGAGCGTATGGGCAGTACTACAATTGGTGCATACTCTGATAGTGCAGGTCATATT
TTCATTAGAGAATCTATTGCTAAGTACATTGCTAAGAGAGATAACCACCTTATCCCACCA
GGTAAATAAAAATATAATTTATAAACAACTAAATAAATTATCAAAAAAGAGATAAACAAA
ATTTGACAAATACCTTTTCAAAACTAAGCTAACTTATAAAAAGGCATCAAAAATAGAAAT
TTAAGTTCAATCTCTTTAAATTGCTGCTATTTTTATAATAGCTCAATATTAAATTAGCTT
AAAAAATGACAATTTTCAAGAGTTAGGATAGCATTTTTTTCCTAATTTAGTTAAATAAAA
GCAAAGAGCTTGAAAAGTAAGTTAATGAAGCAAATATTATTATTTAATAGATTAATTAAA
TGCCAAATTAAAAAAAGTAAAAATTTCTAATTACTTAACAAGCTTGATGAATATTTTAAT
ATTAAAAAATAAAAAAAATAAATTGATTCAAACTACTAACTAGCAACTTCAAATTTGAAT
TATTTCTATCAAATTATAATGATGATTTTTTTAAGTAGAGAATAGGATTTATTGAAAAAT
TAATAATAAAGTATTTGAAATAAATTAAATTTTTTTAATTAAAATTAATTTTTAGATGTT
AATGATATCATCCTCACTGATGGTGCCAGTCAAGGTGTTCAAATTTGCTTAAATGTACTT
ATTTCTGATTCTAGAGATGGTATCATGATTCCTATTCCTCAATATCCACTCTACTCTGCC
TCATGTACTCTTGTAGGAGCTTCAGAAGTTCACTACTTTTTAGATGAATAAAAGGGATGG
TCTTGCTCTGTTGAAGAATTAAAGAAACAACACAGAGACGCTAAAATGCATGGCATCAAT
CCTAAAATTCTTGTTGTAATCAACCCTGGTAACCCTACTGGCTAGGTATTAAGCTACGAT
ACCATCAAGCAAATGATAGAATTTGCTTATGATCATAAGATGGTTATTTTTGCAGATGAA
GTCTACTAAGATAACATCTACACTCCTAACAAGGAATTCGTCAGCTTTAAGAAAGTTCGT
TCTGAATTACCTTATCCTTATAACAATATTGAGCTATTTTCTTTCCACTCTACTTCTAAG
GGTCTTCTTGGAGAATGTGGTTTGAGAGGAGGTTACTTTGAAATGTGTAACATTGACTCT
CGTGTCAAAGAAGAAATTATTAAGCTCAGATCAATGTTCTTGTGCTCTAACACTGTTGGT
TAATGCACTACTGAATTAATGTGCAATCCTCCTACACTTTAAAATGCTAGTGCTGAAACT
GTAGAGTAATATAATAATGAAAGAAATGCTCTTTTGGAATCTCTTAAAAGAAGAGCCCAA
ATTGTCACTGAATCATTAAATAAAATGACTAATATAACCTGCCAAGAAGTTGAAGGAGCA
ATGTATGCATTCCCTTCTATTAAGTTCGGTAAAAAAGCCCTTGCTGAAGCTGCTAAAAAG
AAAATGGAACCTGATCTTTTCTACTGCTTAAATGTTCTTGAAAACACAGGAATAGTCCTT
GTTCCTGGTAGTGGTTTTAGACAAGAAGAAAACACATATCATTTCCGTATAACTACTCTT
ATCCTTGGAGAGGATCGTCTTAGAGAATCTATGGAAGCTCTTAAAAATTACAATGAAAAA
TTCCATAAAGAATACTGTTGAAATAAATTTAATTAGAATATTGAATAAGTAAAAAAAATA
TTAG