Identifiers and Description

Gene Model Identifier

TTHERM_00301820

Standard Name

None

Aliases

PreTt19378 | 28.m00337 | 3691.m00154

Description

paxneb protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00301820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07711.19.997093137033517e-262hypothetical protein (342 aa)
OxytrichaContig12197.0.g652.999758165421992e-18PAXNEB protein
WormBaseWBGene000161280.00000006998394348458725locus:elpc-4 Putative elonga
tor complex protein 4 status
:Confirmed UniProt:Q18195
protein_id:CCD65198.1
DictyBaseDDB_G02787830.000050024383570459175elp4 on chromosome: 3 position
1174736 to 1176055
SGDYPL101W0.00007000107212225429ELP4 Subunit of Elongator comp
lex, which is required for mod
ification of wobble nucleoside
s in tRNA; required for Elonga
tor structural integrity

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00301820(coding)
ATGAAAATATAGTATAAATTTTTAGAAAATTTGCTTATAGACTCTACTAATTTAACTAGA
AATTTTAATTTTTTTTAAAGATATATTTTCATTAAATTTAATCAATTTAGTAAAATTGTA
TAAAGAATAAATTAAATAGGGATGATAAAAAGCTCATTTGTTAAGAGTGATAAGAATAAA
GCTAAGGATGATTTAAATAAGGCCTTTTTTGGTCATGCTGAATTCGATGCTATTTTTTCT
AACTCAATAAAAAAAGGAACAACTATTTTGATAGAAGAAGATTATCCTACTTCAATGCAT
GTTTCATTTAATAGATATTTTGTAGGATGTGGTTTTCATTTAGAATAAAATTGTTTTGTT
TATGATGTCTTCCCAAAAAGATGGTATGATATGATTCCAGTTAAGAGCACTAGCGAGGAA
AAAAGAGAGTAAGAAAAGTTAGCCATATCCAAGTAAAAGGAAGAAAATAAAATTGCTTGG
AGATATAACCACATGACCATTAAATTAAAAGAAGAGGCCCTCTCAAAGGACATTCCACGT
TTAGATCTTAGTCGTAATGTTGCAGATAAAGAAAAAGTCAAAAACTTATTAATTTCTAAG
GATATAAATTAATTTGGCAATTTGAAAGAACTTTTGGATGATATTTGCAATTCTCTACAA
AACTCATTTTCAAGTGAAAACGATACAAAATTAAAGAAAATTTGTATCACAAACTTATTT
GGAAACTTCTCAAAAATTAAATACACAGATTAAGAACTTATAAAATTTTTATATGCAATT
AAAACTATTACAAGAGCTTCTCATATGCTTTTAGTTTTAACTATTCCTCCTACTATATCA
GAAAAGCTTAAATCTCTATTCTATATGAATTTTGATTTGGTTATTAAGCTTGAACCACTC
TTTGAAAATACTGAATTCCTTGATTTTAATGGAATGCTCCATATCCTTAAATATCCTCAA
ATAAATAATTACTTAAACTTCAAACTAGATACTTTAACATGGGGTCTTAAAGCCTCTTCC
AAAAAAAGAATTGAAATAGAAAAACTTTATCTACAACCACCAGATCAAGATAACATTAAT
GCTGATAATGTTTATAAAGAAGAAAATAAAACTCAAACTATTATATGCAGTAACAAGCCT
TCTGGAAAAACAGATCTCGATTTTTGA


>TTHERM_00301820(protein)
MKIQYKFLENLLIDSTNLTRNFNFFQRYIFIKFNQFSKIVQRINQIGMIKSSFVKSDKNK
AKDDLNKAFFGHAEFDAIFSNSIKKGTTILIEEDYPTSMHVSFNRYFVGCGFHLEQNCFV
YDVFPKRWYDMIPVKSTSEEKREQEKLAISKQKEENKIAWRYNHMTIKLKEEALSKDIPR
LDLSRNVADKEKVKNLLISKDINQFGNLKELLDDICNSLQNSFSSENDTKLKKICITNLF
GNFSKIKYTDQELIKFLYAIKTITRASHMLLVLTIPPTISEKLKSLFYMNFDLVIKLEPL
FENTEFLDFNGMLHILKYPQINNYLNFKLDTLTWGLKASSKKRIEIEKLYLQPPDQDNIN
ADNVYKEENKTQTIICSNKPSGKTDLDF


>TTHERM_00301820(gene)
ATGAAAATATAGTATAAATTTTTAGAAAATTTGCTTATAGACTCTACTAATTTAACTAGA
AATTTTAATTTTTTTTAAAGATATATTTTCATTAAATTTAATCAATTTAGTAAAATTGTA
TAAAGAATAAATTAAATAGGGATGATAAAAAGCTCATTTGTTAAGAGTGATAAGAATAAA
GCTAAGGATGATTTAAATAAGGCCTTTTTTGGTCATGCTGAATTCGATGCTATTTTTTCT
AACTCAATAAAAAAAGGAACAACTATTTTGATAGAAGAAGATTATCCTACTTCAATGCAT
GTTTCATTTAATAGATATTTTGTAGGATGTGGTTTTCATTTAGAATAAAATTGTTTTGTT
TATGATGTCTTCCCAAAAAGATGGTATGATATGATTCCAGTTAAGAGCACTAGCGAGGAA
AAAAGAGAGTAAGAAAAGTTAGCCATATCCAAGTAAAAGGAAGAAAATAAAATTGCTTGG
AGATATAACCACATGACCATTAAATTAAAAGAAGAGGCCCTCTCAAAGGACATTCCACGT
TTAGATCTTAGTCGTAATGTTGCAGATAAAGAAAAAGTCAAAAACTTATTAATTTCTAAG
GATATAAATTAATTTGGCAATTTGAAAGAACTTTTGGATGATATTTGCAATTCTCTACAA
AACTCATTTTCAAGTGAAAACGATACAAAATTAAAGAAAATTTGTATCACAAACTTATTT
GGAAACTTCTCAAAAATTAAATACACAGATTAAGAACTTATAAAATTTTTATATGCAATT
AAAACTATTACAAGAGCTTCTCATATGCTTTTAGTTTTAACTATTCCTCCTACTATATCA
GAAAAGCTTAAATCTCTATTCTATATGAATTTTGATTTGGTTATTAAGCTTGAACCACTC
TTTGAAAATACTGAATTCCTTGATTTTAATGGAATGCTCCATATCCTTAAATATCCTCAA
ATAAATAATTACTTAAACTTCAAACTAGATACTTTAACATGGGGTCTTAAAGCCTCTTCC
AAAAAAAGAATTGAAATAGAAAAACTTTATCTACAACCACCAGATCAAGATAACATTAAT
GCTGATAATGTTTATAAAGAAGAAAATAAAACTCAAACTATTATATGCAGTAACAAGCCT
TCTGGAAAAACAGATCTCGATTTTTGA