Identifiers and Description

Gene Model Identifier

TTHERM_00301770

Standard Name

AMT7 (Adenine MethylTransferase (AMT)7)

Aliases

PreTt19373 | 28.m00332 | 3691.m00149

Description

MT-A70 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00301770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07710.19.997093137033517e-262hypothetical protein (450 aa)
OxytrichaContig17419.0.g367.997402223525235e-19MT-A70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31722409: Wang Y, Sheng Y, Liu Y, Zhang W, Cheng T, Duan L, Pan B, Qiao Y, Liu Y, Gao S (2019) A distinct class of eukaryotic MT-A70 methyltransferases maintain symmetric DNA N6-adenine methylation at the ApT dinucleotides as an epigenetic mark associated with transcription. Nucleic acids research 47(22):11771-11789

Sequences

>TTHERM_00301770(coding)
ATGGCACCAAAAAAATAGGAATAGGAACCAATAAGGTTAAGTACAAGAACAGCATCCAAG
AAGGTTGATTACTTATAGCTCTCTAACGGTAAGCTCGAAGACTTTTTTGATGATTTAGAA
GAGGATAATAAACCCGCCAGAAATCGTTCTCGCTCCAAAAAGAGGGGCAGAAAGCCATTG
AAAAAGGCCGATTCTCGCAGTAAGACACCTTCTAGGGTTTCTAACGCAAGAGGGCGCTCT
AAATCTTTAGGACCACGCAAAACCTACCCTCGCAAAAAAAATTTATCCCCTGACAATTAA
CTCTCTCTCCTTCTTAAGTGGAGAAATGATAAAATTCCTTTAAAGTCAGCCTCAGAAACA
GATAACAAATGCAAAGTTGTTAATGTGAAGAATATATTTAAATCTGATTTGAGTAAATAT
GGAGCTAATTTGTAAGCTTTATTTATAAATGCTCTTTGGAAAGTTAAGAGCAGAAAAGAA
AAAGAAGGATTAAATATAAATGATTTAAGTAACTTAAAAATTCCTCTCTCTTTAATGAAA
AATGGAATCTTATTTATTTGGAGCGAAAAAGAAATTTTAGGATAAATAGTAGAAATCATG
GAACAAAAAGGATTTACATATATCGAAAACTTTTCAATTATGTTTTTAGGCTTAAACAAA
TGCCTTTAATCTATCAACCACAAAGACGAAGATTCATAGAATTCAACAGCCTCAACTAAC
AATACAAATAATGAAGCCATAACAAGCGATTTGACCTTAAAAGATACTTCTAAATTTTCT
GATTAAATACAAGATAACCATAGTGAAGATTCTGATTAAGCAAGAAAATAGTAAACTCCT
GATGATATTACATAAAAGAAAAACAAACTTTTAAAAAAGTCCTCTGTTCCTAGTATTTAA
AAGCTATTTGAGGAAGACCCAGTTTAAACTCCATCTGTAAATAAACCAATAGAAAAAAGC
ATAGAACAAGTTACCTAAGAAAAGAAATTTGTTATGAATAATTTAGATATACTAAAATCA
ACCGACATCAATAACCTATTTTTAAGAAATAATTACCCTTACTTTAAAAAAACTAGACAT
ACACTCCTTATGTTTAGAAGAATTGGAGATAAAAATTAAAAATTAGAGCTCAGACATTAG
AGAACTTCTGATGTAGTTTTTGAAGTTACAGATGAGCAAGACCCTTCAAAAGTAGACACT
ATGATGAAAGAATATGTTTATCAGATGATAGAAACATTATTGCCAAAAGCTTAATTTATT
CCTGGTGTAGATAAACACCTTAAAATGATGGAACTGTAAAATTAGTTAATATTTTTACTA
TTTAAAAACTTAAAAAATTATTAATTAAAATAGATTTGCTAGCACTGA


>TTHERM_00301770(protein)
MAPKKQEQEPIRLSTRTASKKVDYLQLSNGKLEDFFDDLEEDNKPARNRSRSKKRGRKPL
KKADSRSKTPSRVSNARGRSKSLGPRKTYPRKKNLSPDNQLSLLLKWRNDKIPLKSASET
DNKCKVVNVKNIFKSDLSKYGANLQALFINALWKVKSRKEKEGLNINDLSNLKIPLSLMK
NGILFIWSEKEILGQIVEIMEQKGFTYIENFSIMFLGLNKCLQSINHKDEDSQNSTASTN
NTNNEAITSDLTLKDTSKFSDQIQDNHSEDSDQARKQQTPDDITQKKNKLLKKSSVPSIQ
KLFEEDPVQTPSVNKPIEKSIEQVTQEKKFVMNNLDILKSTDINNLFLRNNYPYFKKTRH
TLLMFRRIGDKNQKLELRHQRTSDVVFEVTDEQDPSKVDTMMKEYVYQMIETLLPKAQFI
PGVDKHLKMMELQNQLIFLLFKNLKNYQLKQICQH


>TTHERM_00301770(gene)
ATGGTAATTAATAATATATTTTGCAGTGATTTTAATAATTATAATATAATACAAAAGGCA
CCAAAAAAATAGGAATAGGAACCAATAAGGTTAAGTACAAGAACAGCATCCAAGAAGTAA
TAGAATTAGATTGCAGATATATTACAAAATTCAATTCTTAGCATTTTAAAATCCATTTTA
GCGCAAGAAAAAAAGGAAAAAGCTAGTGAAAAAGCACTGTCTGTGTCACTACTTCTTTTT
ATATTGATATGGCGCAATAAACAAAAAATTATATCGTTATAATAAGCAAATTTTGCAAAT
ATAATACTAAAACATGTTATTTTTAGTGAACCTGAACATAAATTTTGTAAATAAACAGGG
TTGATTACTTATAGCTCTCTAACGGTAAGCTCGAAGACTTTTTTGATGATTTAGAAGAGG
TAATTATTCTTTTTTTTCTCTCTTCAAGCAATAAATTACCAAATTAGCCCATACAAAATT
GCTTTCTTTCTTTTTAAAAAGGATAATAAACCCGCCAGAAATCGTTCTCGCTCCAAAAAG
AGGGGCAGAAAGCCATTGAAAAAGGCCGATTCTCGCAGTAAGACACCTTCTAGGGTTTCT
AACGCAAGAGGGCGCTCTAAATCTTTAGGACCACGCAAAACCTACCCTCGCAAAAAAAAT
TTGTATTTATCTTTTTATGTTATTTTTATTATGACATTCCATAAGCTAATACTATTATTT
AATTCCCCTTAGTTTTTTCTTATATTTTTTAAATACCCATGACTCCCTGCCCTACGTAAT
CCTAATTATTTCACTATTTAAAACTCGTTAAATACGAATTTATACTCTAAAATGGATGCT
TTAGCATTTAAGCATGCGTTTTTAGAAAGATATGCGTGTTTCATAGTGAAATTTTGAAAA
CTCTTACTCATAGTTCTACATTTTATTTTTAGTTCACTTTAAAAAAGAAAGAAAGAAAAA
TAGAAAGCAAATAGTTATTTAAATTCATCCTTAAAAATGCAAAAAAAAACAAGCTTAAGA
TTTGTCAGTTTATATTAGCATTTATGAATGCCATCTTTCGCAATTTGAAAAAGTATTTAT
TTTTTCATTTATAATTTAAAGATCCCCTGACAATTAACTCTCTCTCCTTCTTAAGTGGAG
AAATGATAAAATTCCTTTAAAGTCAGCCTCAGAAACAGATAACAAATGCAAGTAATATTT
TATTTTGTATTTTATTCTTAGATTTCTAATTTTGAGAAATTTATTAAACTAGATTGAATT
AATTAAAATCTTGAATGAATGAATAAACAAATGGAAAAATAAATTAATTCATAATTAAAT
CAAATTTGATATGAAGCCAGAGCAATTTTTTATCATGCTTTAATATTATTTAAAAATCTA
AAAATAGAGTTGTTAATGTGAAGAATATATTTAAATCTGATTTGAGTAAATATGGAGCTA
ATTTGTAAGCTTTATTTATAAATGCTCTTTGGAAAGTTAAGAGCAGAAAAGAAAAAGAAG
GATTAAATATAAATGATTTAAGTAACTTAAAAATTCCTCTCTCTTTAATGAAAAATGGAA
TCTTATTTATTTGGAGCGAAAAAGAAATTTTAGGATAAATAGTAGAAATCATGGAACAAA
AAGGATTTACATATATCGAAAACTTTTCAATTATGTTTTTAGGCTTAAACAAATGCCTTT
AATCTATCAACCACAAAGACGAAGATTCATAGAATTCAACAGCCTCAACTAACAATACAA
ATAATGAAGCCATAACAAGCGATTTGACCTTAAAAGATACTTCTAAATTTTCTGATTAAA
TACAAGATAACCATAGTGAAGATTCTGATTAAGCAAGAAAATAGTAAACTCCTGATGATA
TTACATAAAAGAAAAACAAACTTTTAAAAAAGTCCTCTGTTCCTAGTATTTAAAAGCTAT
TTGAGGAAGACCCAGTTTAAACTCCATCTGTAAATAAACCAATAGAAAAAAGCATAGAAC
AAGTTACCTAAGAAAAGAAATTTGTTATGAATAATTTAGATATACTAAAATCAACCGACA
TCAATAACCTATTTTTAAGAAATAATTACCCTTACTTTAAAAAAACTAGACATACACTCC
TTATGTTTAGAAGAGTAATTCCATTTTAAATATCATAAAAATGTATTCTTATTTAAAAAA
AAAAAATTAGATTGGAGATAAAAATTAAAAATTAGAGCTCAGACATTAGAGAACTTCTGA
TGTAGTTTTTGAAGTTACAGATGAGCAAGACCCTTCAAGTAAAACAAAACTCCTAAAATC
TCTATATATTTTGACATATAATTTATTTATTTTAAATAGAAGTAGACACTATGATGAAAG
AATATGTTTATCAGATGATAGAAACATTATTGCCAAAAGCTTAATTTATTCCTGGTGTAG
ATAAACACCTTAAAATGATGGAACTGTAAAATTAGTTAATATTTTTACTATTTAAAAACT
TAAAAAATTATTAATTAAAATAGATTTGCTAGCACTGA