Identifiers and Description

Gene Model Identifier

TTHERM_00300630

Standard Name

None

Aliases

PreTt19358 | 28.m00317 | 3691.m00135

Description

oxidoreductase, aldo/keto reductase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00248 ) oxidoreductase, aldo/keto reductase family
  • ( TIGR01293 ) voltage-dependent potassium channel beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00300630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07694.19.997093137033517e-262oxidoreductase, aldo/keto redu
ctase (348 aa)
OxytrichaContig10744.0.g1037.0010636619989215e-130Aldo/keto reductase family
Stentor CoeruleusSteCoe_250441.6889118802245324e-48
SGDYPL088W2.9998215087698487e-30YPL088W Putative aryl alcohol
dehydrogenase; transcription i
s activated by paralogous tran
scription factors Yrm1p and Yr
r1p along with genes involved
in multidrug resistance
WormBaseWBGene000155650.0000000000010000211161514907status:Confirmed UniProt:P91
020 protein_id:CCD63508.1
DictyBaseDDB_G02850250.00000000030007160092483236alrE on chromosome: 4 position
2832495 to 2833482

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00300630(coding)
ATGGAATATAGATATTTAGGTAACACTGGCTTGAAGGTATCAGTTATTTCTTTTGGAAAT
TGGCTCAATTCCAACGATTCTACTTGGACTCAAAGGACTATTGATTTGGTGAAAAAAGCT
CATTCATTAGGTATTAATTTCTTTGATACTGCTGAAGTTTATGGTTATGGTGAAGCTGAA
AAGTAAATGGGTTTAGCCTTTAAAGAGCTTAACGTTGCTAGAGAAGATTTAGTTATATCT
ACCAAACTTTTTTGGGCAACAAAAAGCGATACTCTAAATAAGGTTGGTCTATCTAGAAAA
CATGTTATGGAAGGTATTAATAACTCTTTGAAAAAGTTATAATTGGATTATGTAGATATT
GTTTTCTGTCATAGATTTGATAAGTACACACCTTTAGAGGAAACATGCAGGGCTTTCCAT
GATATTATTACATCAGGTAAGGCTCATTACTGGGGAACATCTGAATGGACTGCAGCTTAA
ATTTTCGAAGCCTTCATGATTTGTGAGCGTTTCAATTTAACTAAACCCGTAGTTGAATAA
CCTTAATATAACATGATATTTAGAGAAAAATTTGAAAAAGAATATGGAAGACTTTTTGAT
ATTTACAAGTATGGCTCTACAGTTTGGTCCCCATTATTAGGTGGTATTTTAACAGGAAAG
TACAACGATGGTATAAAACCTGAAGAATAAGGCAGATTAACTACTTTTAGTGATAACAGT
GCTATTCAAAACTAACTAAAAACATACTTTAGCGAAGAAAACAAAGAAAAGTACACCCAT
ATGTTGAAAGGATTAGCTGAAATAGCAAAGGAAATAGGATGCACTTAAGCTCAGTTAGCC
ATGGCTTGGGTTATTAAAAATAAAGATGTTTCAACTGCAATAACTGGTGCTTCTAGACCT
GAACAGCTTGAAGATATAGTAGGCTCTGTAAAATATATCTCAAAAATTACTCCTGAAATA
GAAGCTAGAATCAACACTTTAACAGGAAAAAGACCTGATGGTGAAATGGACTTTAGAGTT
TTTTCCCCACTTGAGCCTAGAAGATGA


>TTHERM_00300630(protein)
MEYRYLGNTGLKVSVISFGNWLNSNDSTWTQRTIDLVKKAHSLGINFFDTAEVYGYGEAE
KQMGLAFKELNVAREDLVISTKLFWATKSDTLNKVGLSRKHVMEGINNSLKKLQLDYVDI
VFCHRFDKYTPLEETCRAFHDIITSGKAHYWGTSEWTAAQIFEAFMICERFNLTKPVVEQ
PQYNMIFREKFEKEYGRLFDIYKYGSTVWSPLLGGILTGKYNDGIKPEEQGRLTTFSDNS
AIQNQLKTYFSEENKEKYTHMLKGLAEIAKEIGCTQAQLAMAWVIKNKDVSTAITGASRP
EQLEDIVGSVKYISKITPEIEARINTLTGKRPDGEMDFRVFSPLEPRR


>TTHERM_00300630(gene)
ATGGAATATAGATATTTAGGTAACACTGGCTTGAAGGTATCAGTTATTTCTTTTGGAAAT
TGGCTCAATTCCAACGATTCTACTTGGACTCAAAGGACTATTGATTTGGTGAAAAAAGCT
CATTCATTAGGTATTAATTTCTTTGATACTGCTGAAGTTTATGGTTATGGTGAAGCTGAA
AAGTAAATGGGTTTAGCCTTTAAAGAGCTTAACGTTGCTAGAGAAGATTTAGTTATATCT
ACCAAACTTTTTTGGGCAACAAAAAGCGATACTCTAAATAAGGTTGGTCTATCTAGAAAA
CATGTTATGGAAGGTATTAATAACTCTTTGAAAAAGTTATAATTGGATTATGTAGATATT
GTTTTCTGTCATAGATTTGATAAGTACACACCTTTAGAGGAAACATGCAGGGCTTTCCAT
GATATTATTACATCAGGTAAGGCTCATTACTGGGGAACATCTGAATGGACTGCAGCTTAA
ATTTTCGAAGCCTTCATGATTTGTGAGCGTTTCAATTTAACTAAACCCGTAGTTGAATAA
CCTTAATATAACATGATATTTAGAGAAAAATTTGAAAAAGAATATGGAAGACTTTTTGAT
ATTTACAAGTAATAAATTATATTTAAATACTTATAAAGATGGTTTAAATAATTTATTTTA
ATTGTTTTCTAAATTTTCTTCATTTTAAATTGTTTATTTTAATCCAAAATAGGTATGGCT
CTACAGTTTGGTCCCCATTATTAGGTGGTATTTTAACAGGAAAGTACAACGATGGTATAA
AACCTGAAGAATAAGGCAGATTAACTACTTTTAGTGATAACAGTGCTATTCAAAACTAAC
TAAAAACATACTTTAGCGAAGAAAACAAAGAAAAGTACACCCATATGTTGAAAGGATTAG
CTGAAATAGCAAAGGAAATAGGATGCACTTAAGCTCAGTTAGCCATGGCTTGGGTTATTA
AAAATAAAGATGTTTCAACTGCAATAACTGGTGCTTCTAGACCTGAACAGCTTGAAGATA
TAGTAGGCTCTGTAAAATATATCTCAAAAATTACTCCTGAAATAGAAGCTAGAATCAACA
CTTTAACAGGAAAAAGACCTGATGGTGAAATGGACTTTAGAGTTTTTTCCCCACTTGAGC
CTAGAAGATGA