Identifiers and Description

Gene Model Identifier

TTHERM_00300380

Standard Name

None

Aliases

PreTt19333 | 28.m00292 | 3691.m00110

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( TIGR03038 ) photosystem II reaction center protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00300380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07671.15.001102406662288e-90hypothetical protein (501 aa)
OxytrichaContig22250.0.g504.999350823993609e-33Protein kinase domain
SGDYPL153C1.0002124404074584e-26RAD53 Protein kinase, required
for cell-cycle arrest in resp
onse to DNA damage; activated
by trans autophosphorylation w
hen interacting with hyperphos
phorylated Rad9p; also interac
ts with ARS1 and plays a role
in initiation of DNA replicati
on
DictyBaseDDB_G02771452.998800627344286e-26pkaD on chromosome: 2 position
7643321 to 7645619
WormBaseWBGene000214611.999790113608142e-24locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
Stentor CoeruleusSteCoe_44390.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00300380(coding)
ATGACTTAATTATTAAATAATAAATACAAGGTTATTCAAGAAATAGGAAATGGATCAATA
GGAAAGGTATTCCTTTGCTAATTTGATGACACTTAAGGTAATTAGATTTAAGTTGCTGTT
AAGCAAATATCAGATCAGACTATATTAGGGTAGCAAAATAAATATCTTGCTTAAGAACTT
AATACTATCTAAATGTTAATAGATCAAATGAATAATGGAAATAAATGTGATCATGTTTTA
CAATGCTATGAAATATTTTAAGAATAGTAATAATATTACATCGTAAGTGAATTTTGCTAG
CTTGGCGATTTATACTAATACTTATATCGAAATCATTAGAATTTATCCACCTAAAATTAT
CTTGATATTATCATTTAAATAGCTAAAGGAATTTAATACCTACATAATATCAATTTAGGA
CACAGAGATTTAAAACCTGAAAATATACTTATTAGATACAATAAAGGTCTCTAGTTAGTT
ATTACAGATTTCGGAGTATCATCTTTTTAAAATATGAAATCAACTGTTGGAACTATAAAT
TATATGGCTCCAGAAATTTTGAAATTTAATTAAAGCTATGACAAAGCAGTAGATATATGG
AGCCTTGGTTGCATAATGCACGAAATAATTTACAATGAACAGCTATTTAATGGCAATACA
ACATAGTAGGTAGTAAGTAAGATAAGAAATTTTAAATTATACTAATAAATAGATTAGAGA
CCTTTCCTTACAGATCTAAATTAGATTATTTAAAGCTGCTTATCTCTAGATGCCTCATAT
AGACCAACTATACAAGATATACTAAATAGATTAGATGAGCTATATAGTAAAATTAAAAAT
AATGAGCACATAGATCAAGATTAAAATTAAATTATCAATTAATAAAATGGAGATTAAAGA
TATGATTAATCAAACTTCACACTAACAAATACAAGTTTCTAAACATTAAATCAAAATTAA
ACTTAATAAGACAATGATTTTAGATAAGAAAGAACTATCTAAGATAATTTCCTTTAAAAA
TTAATCATAGAATGCATATAAAACGATCCTATAAATGAGACCTAATATAGGGAATTTTAA
CAAAATAATGAAAAATAGTTTGTAGATATAAAATCAATTGAAAAGTATTTTAAAAATTTT
TCAAATGATTTACGTAGTGATGAGTGA


>TTHERM_00300380(protein)
MTQLLNNKYKVIQEIGNGSIGKVFLCQFDDTQGNQIQVAVKQISDQTILGQQNKYLAQEL
NTIQMLIDQMNNGNKCDHVLQCYEIFQEQQQYYIVSEFCQLGDLYQYLYRNHQNLSTQNY
LDIIIQIAKGIQYLHNINLGHRDLKPENILIRYNKGLQLVITDFGVSSFQNMKSTVGTIN
YMAPEILKFNQSYDKAVDIWSLGCIMHEIIYNEQLFNGNTTQQVVSKIRNFKLYQQIDQR
PFLTDLNQIIQSCLSLDASYRPTIQDILNRLDELYSKIKNNEHIDQDQNQIINQQNGDQR
YDQSNFTLTNTSFQTLNQNQTQQDNDFRQERTIQDNFLQKLIIECIQNDPINETQYREFQ
QNNEKQFVDIKSIEKYFKNFSNDLRSDE


>TTHERM_00300380(gene)
ATGACTTAATTATTAAATAATAAATACAAGGTTATTCAAGAAATAGGAAATGGATCAATA
GGAAAGGTATTCCTTTGCTAATTTGATGACACTTAAGGTAATTAGATTTAAGTTGCTGTT
AAGCAAATATCAGATCAGACTATATTAGGGTAGCAAAATAAATATCTTGCTTAAGAACTT
AATACTATCTAAATGTTAATAGATCAAATGAATAATGGAAATAAATGTGATCATGTTTTA
CAATGCTATGAAATATTTTAAGAATAGTAATAATATTACATCGTAAGTGAATTTTGCTAG
CTTGGCGATTTATACTAATACTTATATCGAAATCATTAGAATTTATCCACCTAAAATTAT
CTTGATATTATCATTTAAATAGCTAAAGGAATTTAATACCTACATAATATCAATTTAGGA
CACAGAGATTTAAAACCTGAAAATATACTTATTAGATACAATAAAGGTCTCTAGTTAGTT
ATTACAGATTTCGGAGTATCATCTTTTTAAAATATGAAATCAACTGTTGGAACTATAAAT
TATATGGCTCCAGAAATTTTGAAATTTAATTAAAGCTATGACAAAGCAGTAGATATATGG
AGCCTTGGTTGCATAATGCACGAAATAATTTACAATGAACAGCTATTTAATGGCAATACA
ACATAGTAGGTAGTAAGTAAGATAAGAAATTTTAAATTATACTAATAAATAGATTAGAGA
CCTTTCCTTACAGATCTAAATTAGATTATTTAAAGCTGCTTATCTCTAGATGCCTCATAT
AGACCAACTATACAAGATATACTAAATAGATTAGATGAGCTATATAGTAAAATTAAAAAT
AATGAGCACATAGATCAAGATTAAAATTAAATTATCAATTAATAAAATGGAGATTAAAGA
TATGATTAATCAAACTTCACACTAACAAATACAAGTTTCTAAACATTAAATCAAAATTAA
ACTTAATAAGACAATGATTTTAGATAAGAAAGAACTATCTAAGATAATTTCCTTTAAAAA
TTAATCATAGAATGCATATAAAACGATCCTATAAATGAGACCTAATATAGGGAATTTTAA
CAAAATAATGAAAAATAGTTTGTAGATATAAAATCAATTGAAAAGTATTTTAAAAATTTT
TCAAATGATTTACGTAGTGATGAGTATAAGGCAATTGTATTATTGCATCACATATTATGT
TGTAACGTGATTTAAGATACTTAATTTATTTAATAAATTGAAAAGGTGA