Identifiers and Description

Gene Model Identifier

TTHERM_00295610

Standard Name

None

Aliases

PreTt15671 | 27.m00331 | 3692.m00134

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00295610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08828.19.997093137033517e-262protein kinase domain-containi
ng protein (641 aa)
OxytrichaContig20173.0.g433.0012565309061457e-65Protein kinase domain
DictyBaseDDB_G02771652.0008536325002377e-42DDB_G0277165 on chromosome: 2
position 7893420 to 7896232
WormBaseWBGene000039162.00017271388466e-38locus:par-1 Serine/threonine
-protein kinase par-1 status
:Confirmed UniProt:Q9TW45
protein_id:CAB54263.1
SGDYBR274W3.000842737734004e-34CHK1 Serine/threonine kinase a
nd DNA damage checkpoint effec
tor, mediates cell cycle arres
t via phosphorylation of Pds1p
; phosphorylated by checkpoint
signal transducer Mec1p; homo
log of S. pombe and mammalian
Chk1 checkpoint kinase
Stentor CoeruleusSteCoe_35951.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295610(coding)
ATGATAGGTACACAAGAGATTCCAGAAATATAGAACAAAGTTCGTATACTTGATGGAAAA
TATTAAATTTTGTATACAATCGGTGAAGGTCGCTATGCAAAAGTCAAATTGGGAATAGAC
ATGGAAACAAAGAAAAAAGTGGCTATAAAAATTATGAGAGAACAAAGTATTACTGATGAA
AGCAGCCTTGAATTATTTATTAACGAAGTTAAAATATTAAATTAAGTTACTCCAAATCCC
AATATTGTTTAGTTGCAAAGAGTGTGTCTCAATGGTAAATACACAAAATGCGACGGTAGA
GAGTTTGGTGTCTTATATTATGTAATGAAAATTGCTGAAAACGGAGAGTTATTTAAATTT
CTAATGCACACATCTAAGTTTGAAGAAGATCTTGCAAGATTCTTTTTCAAGCAAATTTTA
GAAAGCATAGAATATTTGCATTAAAAAGGAATCTCTCATAGAGATATAAAACCAGAAAAT
ATTCTGATTGACAAAAAACTCAATATAAAACTTTGTGATTTTGGATTTTCTGCAAGATGT
AGAAACGATAAAGGACAAGTTATTTTATTTGATTCATCTGAACCAGTTGGTTCACCTGAA
TACAATCCTCCTGAAATAACATAAAATTAATATAGTGGTATTAAATACAATGCAGAACCT
ATTGATTTATTTTCCTCAGCCTGTGTACTCTTTATGATGGTCATGAGTAGTGCTCCTTTT
GGAAGTACAAGCTCAAGTGATAGATACTACTCTCGCTTTTGCATGGACAACAAGAATAAT
TTCTGGAAAATATTTGCTTATAACTACAAGCCTACAAACGAATTCAAAGACTTAATGCAC
TCTATGCTTGAGCGTGATCCTTAAAAAAGAATAACTGTACAATAAATTAAAATGCACCCA
TGGATGAACGGTCCTATCCCTACTATTGAGGAAGTACAATAATAAATGAATGAAAGAATA
TCTATAGTTTTCAATAAAACTCTTGAAGAGCTTAAGCATAAATTAGAAAATAAGGGATTG
AGTAAAAAGGAAAAACCTCATACTAGACCCCTGAGCAATATTGATGGATTAAAAAATAAA
TACCTCAAATTAGTGCATGATATAAATTAATAAATTTTAAGAAAGATATAAAATGTTAAA
AAACAAAAAATCTTACTAAAATAAGCACAACCCGAGTCTAAAGAAAATATTCCTCATCCA
TTAGAGGAATGTTTACTAAAGTAGAATGAAGATTTTATTATTGAATTTTAAGATCAATAA
TTTTTAACAAATTAAAATATTTCTTCCTCAGAAAACCTATAAAAAAACAGTGTAGCTGCT
TCGTTTTTGAACCAAACTGTTAATCTTTCTACTTAAAAAATATAAAATAAACCAGAAAAG
GAATCATTATCTAAGATTTCTCTAACAGGAATGTAAAAGACAACATCTGGTAACTTAGAA
GAATCTAAAACTGACAGTAAGCCTGCTCATGTTGAAGAAGATGACTTTAGCAACGTAGCC
CCTTTTAAAAAATATTCTTGGTAAAGCAAAGACGATTCTTTCTTTGCATCTAGCTAAAAG
CCATTAAAGATTGCAGCTGTTTAATTCAACGATGATTTTAATTTACTTAATTATTAATAA
AATGAATTCTTTAATACATCTACACCTTCGTGTGACATTTTCAACTCAGAAATAGCAGTT
GCCAGTAATAAAGGAAGAATTTTAAATGCTGATAATTATGAAAATAAAGATAATCCCTCT
TAAATTAATAAGATAAATTAAATAAATTAATAATAATCAAATTAAGCAATTTATCAACCC
AGTTAGAAAAGCCAATAAATAGAACCTCAGAACTAAGAGTAAGAAGGTTTTACACAATAA
AATTTTTAAAGACATGTTAATAATCAACAATCTCTTGCAAAATGA


>TTHERM_00295610(protein)
MIGTQEIPEIQNKVRILDGKYQILYTIGEGRYAKVKLGIDMETKKKVAIKIMREQSITDE
SSLELFINEVKILNQVTPNPNIVQLQRVCLNGKYTKCDGREFGVLYYVMKIAENGELFKF
LMHTSKFEEDLARFFFKQILESIEYLHQKGISHRDIKPENILIDKKLNIKLCDFGFSARC
RNDKGQVILFDSSEPVGSPEYNPPEITQNQYSGIKYNAEPIDLFSSACVLFMMVMSSAPF
GSTSSSDRYYSRFCMDNKNNFWKIFAYNYKPTNEFKDLMHSMLERDPQKRITVQQIKMHP
WMNGPIPTIEEVQQQMNERISIVFNKTLEELKHKLENKGLSKKEKPHTRPLSNIDGLKNK
YLKLVHDINQQILRKIQNVKKQKILLKQAQPESKENIPHPLEECLLKQNEDFIIEFQDQQ
FLTNQNISSSENLQKNSVAASFLNQTVNLSTQKIQNKPEKESLSKISLTGMQKTTSGNLE
ESKTDSKPAHVEEDDFSNVAPFKKYSWQSKDDSFFASSQKPLKIAAVQFNDDFNLLNYQQ
NEFFNTSTPSCDIFNSEIAVASNKGRILNADNYENKDNPSQINKINQINQQQSNQAIYQP
SQKSQQIEPQNQEQEGFTQQNFQRHVNNQQSLAK


>TTHERM_00295610(gene)
ATGATAGGTACACAAGAGATTCCAGAAATATAGAACAAAGTTCGTATACTTGATGGAAAA
TATTAAATTTTGTATACAATCGGTGAAGGTCGCTATGCAAAGTAGATCAATTTTAAACCA
GCATCAAGCTGCTTTTTGTTAGATTTTCTTAACTCTCATAGTCTACATTAACCATTTATA
TAAGTCTGACAAGACTTAATTTCATTAAGATAATAAATATCACAAAGCAGTATTAACGGC
GTTTATTATATTGCAAAATTATTAGAATAAAATTTTTTTTTACAAAGTGATATTTTTAAT
TGAAAAAATACATTTTATTGCTAAAGATATTTGAGTTAGAATGATTCAATTTTTATATGT
TCTCTTTCTAACCATTTGTTTAATCTTTAAATATTTACTATTTAAATAGAGTCAAATTGG
GAATAGACATGGAAACAAAGAAAAAAGTGGCTATAAAAATTATGAGAGAACAAAGTATTA
CTGATGAAAGCAGCCTTGAATTATTTATTAACGAAGTTAAAATATTAAATTAAGTTACTC
CAAATCCCAATATTGTTTAGTTGCAAAGAGTGTGTCTCAATGGTAAATACACAAAATGCG
ACGGTAGAGAGTTTGGTGTCTTATATTATGTAATGAAAATTGCTGAAAACGGAGAGTTAT
TTAAATTTCTAATGCACACATCTAAGTTTGAAGAAGATCTTGCAAGATTCTTTTTCAAGC
AAATTTTAGAAAGTAAATTTTTTCATTCATTTTAGTTAATTTGACGAAACAAATGCCAAA
CAAACCTACTCAAATATTATATTTGTGCCTCCCTGCCTATCTCTATTTACTTAGGCCTTT
ATACTAGTTATTTTTTGTATTATTATTAATTTCTTTTATAATATTTGCACCACAGTTGTA
AACTAACCGAAAATATTAGTAATAAAATACTTATTCAGACATTAATGCTACATGTCTAAA
ACTTATTTACATTATGCTAATTACTTTTATAAAATATTTCATCTTTCTATGAACATACTG
ATCTTATTTTATATTAAAGGCATAGAATATTTGCATTAAAAAGGAATCTCTCATAGAGAT
ATAAAACCAGAAAATATTCTGATTGACAAAAAACTCAATATAAAACTTTGTGATTTTGGA
TTTTCTGCAAGATGTAGAAACGATAAAGGACAAGTTATTTTATTTGATTCATCTGAACCA
GTTGGTTCACCTGAATACAATCCTCCTGAAATAACATAAAATTAATATAGTGGTATTAAA
TACAATGCAGAACCTATTGATTTATTTTCCTCAGCCTGTGTACTCTTTATGATGGTCATG
AGTAGTGCTCCTTTTGGAAGTACAAGCTCAAGTGATAGATACTACTCTCGCTTTTGCATG
GACAACAAGAATAATTTCTGGAAAATATTTGCTTATAACTACAAGCCTACAAACGAATTC
AAAGGTAATTATCTTAGATTTAGTTTTATTTCAATATAATCACCAATCAATTTTCTATTA
AACCAGATATCTTTATCAAAAATTCACCATTAAATATTAAAAAAATTTTTTTCTATTAAA
TTATTTTTTTTTGATAGAAGAAAGTTAAATATAAAAAAAAATTAATTAATTTTAAAGTTC
TTGATGAGAAATTTTTCTAATCTGATAAAAATTATTATAAGACATATTTTACTCAATACA
AAAAATACAATTACTTTAGTATAAAAATATAATTATATTACAAAAACAAAGAGAGAGTAA
AATTTAAATAAGTTAGTTTAAAGCTAAACAAAAATAAAAATTGATTTCTGATGTTAATAA
TTTTAAGTATTTTTTTGATAAATTTTAATTGAAAAAATGGTTCAATAGAAGCATTTTTAT
TTATTGTTGAAAAATAATGGTGAATCACTACTTTTTAAAACAAATAAAGGAATAAATATT
TTTAAATTTTAACAAGGAGATTAAGTAATAAATTTTTAATAAGGGAAATATTGTTTGTGT
TTTCTATTTAAACATTTGAATCTTTCAAGAATTAATTATGATGATCAGTATTATTTTTAA
ATTTCAAAAAGAAACTTTATTATAATTTTAAGAAGCTTATTTACCACAATCTTTTTTTGA
GGATAAATAATCAAAGAATTTTCTAATTTTAATTAATATTTTTTACATTTTTTATTGAAT
AGAAATCTTATTAATTTTTTTAATCAAAAGACTTAATGCACTCTATGCTTGAGCGTGATC
CTTAAAAAAGAATAACTGTACAATAAATTAAAATGCACCCATGGATGAACGGTAAGATAG
TATTTGGAAATTGAATGAAAATTAAAAAATATATTTATGATATATTAGGTCCTATCCCTA
CTATTGAGGAAGTACAATAATAAATGAATGAAAGAATATCTATAGTTTTCAATAAAACTC
TTGAAGAGCTTAAGCATAAATTAGAAAATAAGGGATTGAGTAAAAAGGAAAAACCTCATA
CTAGACCCCTGAGCAATATTGATGGATTAAAAAATAAATACCTCAAATTAGTGCATGATA
TAAATTAATAAATTTTAAGAAAGATATAAAATGTTAAAAAACAAAAAATCTTACTAAAAT
AAGCACAACCCGAGTCTAAAGAAAATATTCCTCATCCATTAGAGGAATGTTTACTAAAGT
AGAATGAAGATTTTATTATTGAATTTTAAGATCAATAATTTTTAACAAATTAAAATATTT
CTTCCTCAGAAAACCTATAAAAAAACAGTGTAGCTGCTTCGTTTTTGAACCAAACTGTTA
ATCTTTCTACTTAAAAAATATAAAATAAACCAGAAAAGGAATCATTATCTAAGATTTCTC
TAACAGGAATGTAAAAGACAACATCTGGTAACTTAGAAGAATCTAAAACTGACAGTAAGC
CTGCTCATGTTGAAGAAGATGACTTTAGCAACGTAGCCCCTTTTAAAAAATATTCTTGGT
AAAGCAAAGACGATTCTTTCTTTGCATCTAGCTAAAAGCCATTAAAGATTGCAGCTGTTT
AATTCAACGATGATTTTAATTTACTTAATTATTAATAAAATGAATTCTTTAATACATCTA
CACCTTCGTGTGACATTTTCAACTCAGAAATAGCAGTTGCCAGTAATAAAGGAAGAATTT
TAAATGCTGATAATTATGAAAATAAAGATAATCCCTCTTAAATTAATAAGATAAATTAAA
TAAATTAATAATAATCAAATTAAGCAATTTATCAACCCAGTTAGAAAAGCCAATAAATAG
AACCTCAGAACTAAGAGTAAGAAGGTTTTACACAATAAAATTTTTAAAGACATGTTAATA
ATCAACAATCTCTTGCAAAATGA