Identifiers and Description

Gene Model Identifier

TTHERM_00295410

Standard Name

None

Aliases

PreTt15651 | 27.m00311 | 3692.m00114

Description

elongation factor Tu GTP-binding domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF08955 ) Domain of unkown function (DUF1901)
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00295410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08807.19.997093137033517e-262hypothetical protein (683 aa)
OxytrichaContig12931.0.g1121.9991939848149086e-4450S ribosome-binding GTPase
DictyBaseDDB_G02816038.99682777598231e-22DDB_G0281603 on chromosome: 3
position 4698687 to 4700710
Stentor CoeruleusSteCoe_276322.1151310375910805e-19
WormBaseWBGene000038210.000009999254677478949locus:nst-1 Guanine nucleoti
de-binding protein-like 3 homo
log status:Confirmed UniPr
ot:Q21086 protein_id:CAA8886
0.1
SGDYER006W0.00010003404299092957NUG1 GTPase that associates wi
th nuclear 60S pre-ribosomes,
required for export of 60S rib
osomal subunits from the nucle
us

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295410(coding)
ATGATGATAGTTAGCAAAATAAAGAGAGTTATTAAAGTTGAAAATTCTTTTAAGAACTTA
GTCACTTAATTAAATAAATTTTAATAATGTAATAAATCACTATAGTATAACCAAGAGTTA
TAAAATAGGATTAGCTTTTAGTTTTGTTCCAAGCCATATAATAAATTTAATGATTCTACT
CATTTCAATAAAGTAGGAAGTGATACAAAAAGAAATGATTAAAATAAAAAGTCTTTAGAG
TATGAATAGAATTCTATTTTGAAATAATTAGAATTGGATGAATTTTAAATACCTAAAAAT
TATAAAAATTGTACAGGATGTGGTGTAAAATTTTAAATAGAGCATCAAAATAAGTTGGGC
TATATCGATAAAAAAGTACTTAAAGAAATAGTTGATCACAATAAAAGAATAGATGAAGAA
ATAGAAAATGGAGATATTGTTGTTAAGCGTTCTAATTAGTTTGATGAAAGCGATTACATT
AGTAAATATATGATTTAAAATAACAAGTTGTAATAGCTTAAGAATACAGATCATAAATAA
TTTATTGAAATCGAAGATTTAGATATGTTAGAAGAAATCGAATCCAAAAAAGAAAATATG
ACTGTTTACAAAAGAAAAGAAAAAAATTTAAAATATAAAAAGCCTATTTGCTACAGATGC
CATTAATTAAAATATCAAAAAAATTTAATTGATTAATAATCTGAAATTTCTAGATAGAAT
CAATAAGAGTAAAACTAGTAGAGCAATCTCTCTGATGATGAAAATGAAGATCACTAACAA
GAATTAGAGATGACTGATTTTGAAAAAGGTGATCTTTTAGCTACAAAAGATCCATCAGAA
TTTTTGAAAAAAGCCTTTAAGTTGGTAAAGCGTAATTCAACTATTATATTTGTCGTAGAT
GCCACTGATTTATTTGCAACTCTCAACACTTCTATTGTCGACTATGCTTTTGCTTAAAAC
CATAAAATCATATTAGCTGTTAATAAAATTGATGCTCTTCCTCCAAATAATGTCTAGTTT
AACCAATTAAAAAGTGTTGTTAAGAAATGCATTTTAGAAAAATATCCTAATAATCTTCAT
CTACTAGAAGATATAGTTTTAGTAAGCGCTAAAAGCGGTGAAGGCTTGGAAAAGATTACT
AAATACATTATATCTGCTAAAATGGAATCTAAATAATATTAACATAGCAGATACTCCAAG
AACTTTTATGTGATGGGATTTGCCAATACAGGAAAATCTTCTTTTATTAATGCTTTAAAC
AGACAAACAAAAAAACTTTTGAAAAAATAGGAAGATCAGCAAACTAATTCTAATCCAGAA
AATCTTAATTCATAAGATAAGCTAATGATTAAAAGGCTTTTAGGTGGAACATCAGTAGGT
GGAGAAGAGGATGATTAAGAATTAACAACTAGCTCTATACCTGGTACAACTGTTTCATTT
GTTAAATCAAGAAATAAAAGATTAAATGTAAACATTTATGATACTCCAGGTATTCCTAAC
CCTCATTAGTTGTACCACTACTTTTCCAACCCCACCGATGCAAAAATTATAGTTATAGAT
AAAAAAATATCTCCATAAGTCTTTACAATCAGTAAAGATCTCAGCGTATTTTTTGGAGGA
CTAGCACGTATAGACTAAACATAAGGAATAGACGTGAACGCAGCTGTATTCATGTCATCT
CATATTGCTGTCCACGTAACAAAATCTTACAAAGCTAACGAGGTATTCATTAAGCAGTAT
AATAATATCCTTGTTCCTGTTCTTAATCCTGATTTTACTTAGATCATTTTCTAGAGACAC
GTGATAGATATTTCTTTCGATTCAAAAGGCAGATGTAACTAAGATTTAGAAATATTTGGA
CTTGGTTGGTTAAGCTTTACTTCATAAAAAGTTTGCAAAGGAGAAGCTTAATTCTTTTTA
TATTTGCCAGAAGGAGTTTAATATAAATTAAGAGAATCATTTTATAAATTTGATATAAGC
TTGATGAGTAAAAAAATAAGAACAAAGCAAGTTCATTCTAATGTGATTGAAAAACAAAAA
TAAATAAATATTTCTAAATTAAAATAAAATTGA


>TTHERM_00295410(protein)
MMIVSKIKRVIKVENSFKNLVTQLNKFQQCNKSLQYNQELQNRISFQFCSKPYNKFNDST
HFNKVGSDTKRNDQNKKSLEYEQNSILKQLELDEFQIPKNYKNCTGCGVKFQIEHQNKLG
YIDKKVLKEIVDHNKRIDEEIENGDIVVKRSNQFDESDYISKYMIQNNKLQQLKNTDHKQ
FIEIEDLDMLEEIESKKENMTVYKRKEKNLKYKKPICYRCHQLKYQKNLIDQQSEISRQN
QQEQNQQSNLSDDENEDHQQELEMTDFEKGDLLATKDPSEFLKKAFKLVKRNSTIIFVVD
ATDLFATLNTSIVDYAFAQNHKIILAVNKIDALPPNNVQFNQLKSVVKKCILEKYPNNLH
LLEDIVLVSAKSGEGLEKITKYIISAKMESKQYQHSRYSKNFYVMGFANTGKSSFINALN
RQTKKLLKKQEDQQTNSNPENLNSQDKLMIKRLLGGTSVGGEEDDQELTTSSIPGTTVSF
VKSRNKRLNVNIYDTPGIPNPHQLYHYFSNPTDAKIIVIDKKISPQVFTISKDLSVFFGG
LARIDQTQGIDVNAAVFMSSHIAVHVTKSYKANEVFIKQYNNILVPVLNPDFTQIIFQRH
VIDISFDSKGRCNQDLEIFGLGWLSFTSQKVCKGEAQFFLYLPEGVQYKLRESFYKFDIS
LMSKKIRTKQVHSNVIEKQKQINISKLKQN


>TTHERM_00295410(gene)
ATGATGATAGTTAGCAAAATAAAGAGAGTTATTAAAGTTGAAAATTCTTTTAAGAACTTA
GTCACTTAATTAAATAAATTTTAATAATGTAATAAATCACTATAGTATAACCAAGAGTTA
TAAAATAGGATTAGCTTTTAGTTTTGTTCCAAGCCATATAATAAATTTAATGATTCTACT
CATTTCAATAAAGTAGGAAGTGATACAAAAAGAAATGATTAAAATAAAAAGTCTTTAGAG
TATGAATAGAATTCTATTTTGAAATAATTAGAATTGGATGAATTTTAAATACCTAAAAAT
TATAAAAATTGTACAGGATGTGGTGTAAAATTTTAAATAGAGCATCAAAATAAGTTGGGC
TATATCGATAAAAAAGTACTTAAAGAAATAGTTGATCACAATAAAAGAATAGATGAAGAA
ATAGAAAATGGAGATATTGTTGTTAAGCGTTCTAATTAGTTTGATGAAAGCGATTACATT
AGTAAATATATGATTTAAAATAACAAGTTGTAATAGCTTAAGAATACAGATCATAAATAA
TTTATTGAAATCGAAGATTTAGATATGTTAGAAGAAATCGAATCCAAAAAAGAAAATATG
ACTGTTTACAAAAGAAAAGAAAAAAATTTAAAATATAAAAAGCCTATTTGCTACAGATGC
CATTAATTAAAATATCAAAAAAATTTAATTGATTAATAATCTGAAATTTCTAGATAGAAT
CAATAAGAGTAAAACTAGTAGAGCAATCTCTCTGATGATGAAAATGAAGATCACTAACAA
GAATTAGAGATGACTGATTTTGAAAAAGGTGATCTTTTAGCTACAAAAGATCCATCAGAA
TTTTTGAAAAAAGCCTTTAAGTTGGTAAAGCGTAATTCAACTATTATATTTGTCGTAGAT
GCCACTGATTTATTTGCAACTCTCAACACTTCTATTGTCGACTATGCTTTTGCTTAAAAC
CATAAAATCATATTAGCTGTTAATAAAATTGATGCTCTTCCTCCAAATAATGTCTAGTTT
AACCAATTAAAAAGTGTTGTTAAGAAATGCATTTTAGAAAAATATCCTAATAATCTTCAT
CTACTAGAAGATATAGTTTTAGTAAGCGCTAAAAGCGGTGAAGGCTTGGAAAAGATTACT
AAATACATTATATCTGCTAAAATGGAATCTAAATAATATTAACATAGCAGATACTCCAAG
AACTTTTATGTGATGGGATTTGCCAATACAGGAAAATCTTCTTTTATTAATGCTTTAAAC
AGACAAACAAAAAAACTTTTGAAAAAATAGGAAGATCAGCAAACTAATTCTAATCCAGAA
AATCTTAATTCATAAGATAAGCTAATGATTAAAAGGCTTTTAGGTGGAACATCAGTAGGT
GGAGAAGAGGATGATTAAGAATTAACAACTAGCTCTATACCTGGTACAACTGTTTCATTT
GTTAAATCAAGAAATAAAAGATTAAATGTAAACATTTATGATACTCCAGGTATTCCTAAC
CCTCATTAGTTGTACCACTACTTTTCCAACCCCACCGATGCAAAAATTATAGTTATAGAT
AAAAAAATATCTCCATAAGTCTTTACAATCAGTAAAGATCTCAGCGTATTTTTTGGAGGA
CTAGCACGTATAGACTAAACATAAGGAATAGACGTGAACGCAGCTGTATTCATGTCATCT
CATATTGCTGTCCACGTAACAAAATCTTACAAAGCTAACGAGGTATTCATTAAGCAGTAT
AATAATATCCTTGTTCCTGTTCTTAATCCTGATTTTACTTAGATCATTTTCTAGAGACAC
GTGATAGATATTTCTTTCGATTCAAAAGGCAGATGTAACTAAGATTTAGAAATATTTGGA
CTTGGTTGGTTAAGCTTTACTTCATAAAAAGTTTGCAAAGGAGAAGCTTAATTCTTTTTA
TATTTGCCAGAAGGAGTTTAATATAAATTAAGAGAATCATTTTATAAATTTGATATAAGC
TTGATGAGTAAAAAAATAAGAACAAAGCAAGTTCATTCTAATGTGATTGAAAAACAAAAA
TAAATAAATATTTCTAAATTAAAATAAAATTGA