Identifiers and Description

Gene Model Identifier

TTHERM_00295400

Standard Name

None

Aliases

PreTt15650 | 27.m00310 | 3692.m00113

Description

tRNA uridine 5-carboxymethylaminomethyl modification enzyme mnmg protein; glucose-inhibited division protein A containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07656 ) KWG Leptospira
  • ( PF00890 ) FAD binding domain
  • ( PF03486 ) HI0933-like protein
  • ( TIGR01813 ) flavocytochrome c
  • ( PF01266 ) FAD dependent oxidoreductase
  • ( TIGR00137 ) tRNA:m(5)U-54 methyltransferase
  • ( TIGR02032 ) geranylgeranyl reductase family
  • ( PF01134 ) Glucose inhibited division protein A
  • ( PF07992 ) pyridine nucleotide-disulphide oxidoreductase
  • ( TIGR00136 ) tRNA uridine 5-carboxymethylaminomethyl modification enzyme
  • ( TIGR01812 ) succinate dehydrogenase or fumarate reductase,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00295400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08806.19.997093137033517e-262glucose-inhibited division pro
tein A containing protein (705
aa)
DictyBaseDDB_G02891839.997093137033517e-262DDB_G0289183 on chromosome: 5
position 2445521 to 2447857
OxytrichaContig3095.0.g489.997093137033517e-262Glucose inhibited division pro
tein A
SGDYGL236C9.997093137033517e-262MTO1 Mitochondrial protein, fo
rms a heterodimer complex with
Mss1p that performs the 5-car
boxymethylaminomethyl modifica
tion of the wobble uridine bas
e in mitochondrial tRNAs; requ
ired for respiration in paromo
mycin-resistant 15S rRNA mutan
ts
WormBaseWBGene000099442.0000633521090825e-149Uncharacterized protein F52H3.
2 status:Confirmed UniProt
:Q20680 protein_id:CAA91322.
1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295400(coding)
ATGTTTAGATTCTTAAAGAAGAATTAAGGCATACTATATAGATAGAATTCCCTCTTATAT
GGGTTTTCTTAAACAATTTCTTTTTAAGCAAATAATAAGTATGACGTAGTTGTAATTGGA
GGCGGTCATGCAGGATGCGAAGCTGCTTATGCTGCTGCAAGAACTGGAGCTAAAACGCTT
CTACTAACATAGAAAAAATAGACTGTTGGAGAAATGAGTTGCAATCCTTCAATGGGTGGT
ATTGGAAAAGGAAATTTAATTAGAGAAATAGATGCCCTAGGAGGATTAATGGGCCGTATG
GCTGATCTCTCAGGAATTTAATACAAAGTTCTGAACTCTAGTAAAGGTGCTGCTGTATAA
GGACCTCGTGCTTAAATAGATAGAGATTCATATAAAAAGAACATGCAGAACTTTTTATTC
AATCAAGTCCCTAACCTTGATGTTGCTGAAGCAAGTGCTGAAGATTTATTATTAGATGAG
AAGACCCACTCTATAAAAGGTGTTAAGACTTAAAATAATGAAAATATATACTCCAAAAGC
GTCGTTATTACTACTGGTACTTTTTTAAGAGCATATTGCCATATAGGACATAAGAGGTAT
CCCGCAGGAAGACATATCAGAGATTCTGATTAAGTAGAACCACCTTCCATAGGCTTAGCC
AAAACTTTAGAAAGATATCAATTCCATATTGCTAGATATACTACTGGAACTCCAGCTAGA
ATCGACAGAAATAGCATAAATTTCGAAGGCTTAGAAACACAAGAAAGTGATGAAATAATT
ACTCCTTTTAGCTTTGTTCATGAGTTTTACAGCCCTTTCATACCTCCTAATCCATTAGTT
AAATGCTACATTACACAGACTAATTCAAAAACTCATGACATAATTAATTCAAACAGATAG
TTCTTGCCTAAATTTACTTTCAATGATGGTAAAGGGCTAGGTCCTCGTTATTGCCCAGCT
ATAGAGAAAAAAGTAATTAGATTCCCTGATAAGAAATATCATTAAGTCTGGTTAGAGCCT
GAAGGTTACAACAACAATATTATTTATCCAAATGGATTAAATACAGCTTTCCCAGAAGAG
ATTTAATTAGATTTGCTTAGATCTATTAAAGGTCTCGAAAATTGTGTAATGACTCGTCCA
GGCTATGCAGTTGAATATGACTTTGTAAATCCTCAAGAACTTAAGAAGTCACTGGAAACA
AGAAAAATAAAAGGATTGTATTTAGCTGGCTAAATAAATGGTACAACAGGGTATGAAGAA
GCAGCTAGTCAAGGTATAATAGCTGGTATAAATGCTGGTTAAGAGTGTTAAGGAAAAGAA
CCATTAATCCTCGACAGAAGTGAAGCCTTTATTGGTGTATTAATAGATGATTTAATTTCT
TTGGGAATTTCAGAACCTTACAGAATGTTTACTTCTAGATCAGAATTCAGATTGAGTTTA
AGAGCTGAAAATGCTGATTTCAGATTAACACCTTATGGAATAAAATTAGGAATAATAAAC
AAAGAATAAGAAGAAGTTTTTAGATAAAAATATCATATGAAAGTTAAAGGAATGCATAAT
TTAATGAATTTTAAAATGTTAAGTAGAGATTGGTAAAAAAAGGGTATAAACATTGATCCA
TAACAGCCTGGATACAAGAGTGCTGCAGATATTATAGAAAAATATGATAAAAATATAGAT
GAAATATCATCAGCTTTTAATAATTTATTTGAAATTGAACCATAAATCAAAAAGCATTTA
GAAACTGAATGCAAATATAGAACTTATCTTGACAAGCAGACAAAGGAAATTCTTAATTTA
CAAAAGAACTTAAATAGTATTGATATTAGTGAGATTGATTTAGAAAGTATAAAGCACACT
GCAACAAAAGAAGAAATAGAGTTATTATCAAATCATAAACCTAGAACAATTTATGCAGCT
AGTAGAATACCAGGTATAAGACCAACTACTTTAGTTTAGATGCTTTACTTAGCCAAAAAA
GGTGCAGAAAATGAATCTCCAGTTGTTACTTAATGA


>TTHERM_00295400(protein)
MFRFLKKNQGILYRQNSLLYGFSQTISFQANNKYDVVVIGGGHAGCEAAYAAARTGAKTL
LLTQKKQTVGEMSCNPSMGGIGKGNLIREIDALGGLMGRMADLSGIQYKVLNSSKGAAVQ
GPRAQIDRDSYKKNMQNFLFNQVPNLDVAEASAEDLLLDEKTHSIKGVKTQNNENIYSKS
VVITTGTFLRAYCHIGHKRYPAGRHIRDSDQVEPPSIGLAKTLERYQFHIARYTTGTPAR
IDRNSINFEGLETQESDEIITPFSFVHEFYSPFIPPNPLVKCYITQTNSKTHDIINSNRQ
FLPKFTFNDGKGLGPRYCPAIEKKVIRFPDKKYHQVWLEPEGYNNNIIYPNGLNTAFPEE
IQLDLLRSIKGLENCVMTRPGYAVEYDFVNPQELKKSLETRKIKGLYLAGQINGTTGYEE
AASQGIIAGINAGQECQGKEPLILDRSEAFIGVLIDDLISLGISEPYRMFTSRSEFRLSL
RAENADFRLTPYGIKLGIINKEQEEVFRQKYHMKVKGMHNLMNFKMLSRDWQKKGINIDP
QQPGYKSAADIIEKYDKNIDEISSAFNNLFEIEPQIKKHLETECKYRTYLDKQTKEILNL
QKNLNSIDISEIDLESIKHTATKEEIELLSNHKPRTIYAASRIPGIRPTTLVQMLYLAKK
GAENESPVVTQ


>TTHERM_00295400(gene)
ATGTTTAGATTCTTAAAGAAGAATTAAGGCATACTATATAGATAGAATTCCCTCTTATAT
GGGTTTTCTTAAACAATTTCTTTTTAAGCAAATAATAAGTATGACGTAGTTGTAATTGGA
GGCGGTCATGCAGGATGCGAAGCTGCTTATGGTAAAAGATCTTTATATTTTTAGTTTTAT
TTTAAATTAAATCATGTAGTCTCTTGTGAGATAATAGAAATAATAATTTTTTTTGTTATA
AAATAAAATTAGCTGCTGCAAGAACTGGAGCTAAAACGCTTCTACTAACATAGAAAAAAT
AGACTGTTGGAGAAATGAGTTGCAATGTAAGTTGAGATATATATATTATAAGCGCAATTG
ATTAATTAAATCAAGCTTATTATATAAAATAAAAACTAATTTTATTTGTAAATAAATTGA
TTTTATTAAATTATTAATTAGCCTTCAATGGGTGGTATTGGAAAAGGAAATTTAATTAGA
GAAATAGATGCCCTAGGAGGATTAATGGGCCGTATGGCTGATCTCTCAGGAATTTAATAC
AAAGTTCTGAACTCTAGTAAAGGTGCTGCTGTATAAGGACCTCGTGCTTAAATAGATAGA
GATTCATATAAAAAGAACATGCAGAACTTTTTATTCAATCAAGTCCCTAACCTTGATGTT
GCTGAAGCAAGGTAAACAAAATTGACATCAAATTAATAATAACTTTTAAGGGTTCTTTTA
AAACTTAAAATTTGTTATAACTTATAAAATAAGTGCTGAAGATTTATTATTAGATGAGAA
GACCCACTCTATAAAAGGTGTTAAGACTTAAAATAATGAAAATATATACTCCAAAAGCGT
CGTTATTACTACTGGTACTTTTTTAAGAGCATATTGCCATATAGGACATAAGAGGTATCC
CGCAGGAAGACATATCAGAGATTCTGATTAAGTAGAACCACCTTCCATAGGCTTAGCCAA
AACTTTAGAAAGATATCAATTCCATATTGCTAGATATACTACTGGAACTCCAGCTAGAAT
CGACAGAAATAGCATAAATTTCGAAGGCTTAGAAACACAAGAAAGTGATGAAATAATTAC
TCCTTTTAGCTTTGTTCATGAGTTTTACAGCCCTTTCATACCTCCTAATCCATTAGGTAT
TATTAATTTTAAAAGATAATATTAATTGTTTGTATCCACAAACTTTTAGTTTAAATAATT
TTGAATGAAGGAATGAATGAATTCAAACTTGAGATTTTTTTCTAGTTAGTTCTATTTTTT
TAATTAATCTGGTTCAAACAAATTTGTTAATCAACTTTTCTTAATTATAAATAGTTAAAT
GCTACATTACACAGACTAATTCAAAAACTCATGACATAATTAATTCAAACAGATAGTTCT
TGCCTAAATTTACTTTCAATGATGGTAAAGGGCTAGGTCCTCGTTATTGCCCAGCTATAG
AGAAAAAAGTAATTAGATTCCCTGATAAGAAATATCATTAAGTCTGGTTAGAGCCTGAAG
GTTACAACAACAATATTATTTATCCAAATGGATTAAATACAGCTTTCCCAGAAGAGATTT
AATTAGATTTGCTTAGATCTATTAAAGGTTTTAATCATATTAAGTAAATGAAATATTAAA
ATAATAAAAAATTATTTTTATAGGTCTCGAAAATTGTGTAATGACTCGTCCAGGCTATGC
AGTTGAATATGACTTTGTAAATCCTCAAGAACTTAAGAAGTCACTGGAAACAAGAAAAAT
AAAAGGATTGTATTTAGCTGGCTAAATAAATGGTACAACAGGGTATGAAGAAGCAGCTAG
TCAAGGTATAATAGCTGGTATAAATGCTGGTTAAGAGTGTTAAGGAAAAGAACCATTAAT
CCTCGACAGAAGTGAAGCCTTTATTGGTGTATTAATAGATGATTTAATTTCTTTGGGAAT
TTCAGAACCTTACAGAATGTTTACTTCTAGGTAAAGTTTAATTTAATTAAATTGATTAAT
CTAATTCATTAATTTTTTATTTCAATAAAATAGATCAGAATTCAGATTGAGTTTAAGAGC
TGAAAATGCTGATTTCAGATTAACACCTTATGGAATAAAATTAGGAATAATAAACAAAGA
ATAAGAAGAAGTTTTTAGATAAAAATATCATATGAAAGTTAAAGGAATGCATAATTTAAT
GAATTTTAAAATGTTAAGTAGAGATTGGTAAAAAAAGGGTATAAACATTGATCCATAACA
GCCTGGATACAAGAGTGCTGCAGATATTATAGAAAAATATGATAAAAATATAGATGAAAT
ATCATCAGCTTTTAATAATTTATTTGAAATTGAACCATAAATCAAAAAGCATTTAGAAAC
TGAATGCAAATATAGAACTTATCTTGACAAGCAGACAAAGGTAATTTTTTGCTTTTCTAA
ATAATTATAAATGCATCAACTTATTAATTTAAATTATTAGGAAATTCTTAATTTACAAAA
GAACTTAAATAGTATTGATATTAGTGAGATTGATTTAGAAAGTATAAAGCACACTGCAAC
AAAAGAAGAAATAGAGTTATTATCAAATCATAAACCTAGAACAATTTATGCAGCTAGTAG
AATACCAGGTATAAGACCAACTACTTTAGTTTAGATGCTTTACTTAGCCAAAAAAGGTGC
AGAAAATGAATCTCCAGTTGTTACTTAATGA