Identifiers and Description

Gene Model Identifier

TTHERM_00295020

Standard Name

None

Aliases

PreTt15612 | 27.m00272 | 3692.m00075

Description

RING finger related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00295020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08765.19.999142814001536e-47hypothetical protein (160 aa)
OxytrichaContig3319.0.g780.000000000000005001692698841201Ring finger domain
DictyBaseDDB_G02824790.0000000000019997478866288316DDB_G0282479 on chromosome: 3
position 5826574 to 5827634
WormBaseWBGene000072260.000000019990673443141236status:Confirmed UniProt:Q17
573 protein_id:CAA84635.1
SGDYBR062C0.0004000184047659232YBR062C Protein of unknown fun
ction that interacts with Msb2
p; may play a role in activati
on of the filamentous growth p
athway.

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295020(coding)
ATGTAAATCTAAATTCATGATCTTAGTTTGTAATTATTCTCAAAAATCACCATAAGAATC
AATTTTATTAAATATTTTTAAGCTGAATAAATCTCTATAAATAACAAAGTGATCAAATTC
TTCTTTAAATCTATAAAGAAGTAAATAGGAGAAAGTTTATAAAACTCCAAATTATAAAAG
CTACTTATCATATTATTATTTTATATCAGAATTCTTTTGAATAAAATTATTTAAATGTTG
AGTAGATTTCAAAGTTAATAGTAAAACCCTCAAAATAATTAGTAGGATAATAACATTTCA
TTTATCTCATATGAAAATGAGAGAGTAGCTGTAAGAAGAAATTTTTTGGAAAACCTTAAG
GTGTCTCTTCACGAATCGTTTGTTACTAATATAGGATTAGTTTGCCTTTCTAGTTTGAAA
ATTACAGCAATCATTTTAGTTTTTATCTTAGAAAAAATACCAAAACTTGAAAACGGAAAC
CAAGATTTTTAAATAAATGAGAAGCAATTATAAGGAGTGTATGAGATTAAGCTGTGGCTA
ATATTTATGATTGCATATGATGGACTGAATATATTTTACTTATTTTATACAATTTACATA
ATTGGTAAATACAATAAAGCTGCTTATAGGAGAGGGTAAGGAGAAAATTCCTTATAAGAT
GGATAAATAATTTATAATGATCAGCAGAGCTCTGCATATTTGCAAACTAATTAGATGATA
CAATCGTAAATAAGTCTTGATATGGAATAAAATTTATATTAAAATGGTCAAAATGATATG
ATTAATGAACCTTTAAATGAGTACTACTATCAATAATATAGCTCGCCTTTATCAATTAAC
CACCAAATAAACTTTTTAGAATTAGCAAGTAATAGGAATAAAGTATTAAAGTACAGCTCT
CTAGCAACAAAAATATCTTACTTAGTCTTGTTCTTATTGGGAAACTATTTTGCATATATT
AATAAAAGCTGTTCTAGTTAGTTCCCTTACCATTATTATCTACTCTTATGGCTTGTGGCA
CTAGGATATTTTTCATTTGGAATATAAATTTTACTCTTGCTTTCAATCTGTTTGTGCTTT
CCATTAACATTATTCCTTTATGTTTTGATGAGAAATAGAACTAACTCTTCAATTCCGGCA
AACAATGAAATTATAAAAAGACTATAACCATAAAAATACAAAGACAAAATAAACAATTCA
GAATTTGATACATAAAAAGAATGTTGCATTTGTCTGGTAGATTATTAATCTGACGATTTA
ATCATAAGTTTACCTTGCAGTAAATTGCATCATTATCATTATGATTGTGTTGTTAAGTGG
TTAAATATCAGTGGAGTCTGTCCTATATGCAAGAAACCTTTGGAGTAATATGTTTAAGAA
TTAGAAGAAGTAAAGCAAAACTACCAATTCTATTGA


>TTHERM_00295020(protein)
MQIQIHDLSLQLFSKITIRINFIKYFQAEQISINNKVIKFFFKSIKKQIGESLQNSKLQK
LLIILLFYIRILLNKIIQMLSRFQSQQQNPQNNQQDNNISFISYENERVAVRRNFLENLK
VSLHESFVTNIGLVCLSSLKITAIILVFILEKIPKLENGNQDFQINEKQLQGVYEIKLWL
IFMIAYDGLNIFYLFYTIYIIGKYNKAAYRRGQGENSLQDGQIIYNDQQSSAYLQTNQMI
QSQISLDMEQNLYQNGQNDMINEPLNEYYYQQYSSPLSINHQINFLELASNRNKVLKYSS
LATKISYLVLFLLGNYFAYINKSCSSQFPYHYYLLLWLVALGYFSFGIQILLLLSICLCF
PLTLFLYVLMRNRTNSSIPANNEIIKRLQPQKYKDKINNSEFDTQKECCICLVDYQSDDL
IISLPCSKLHHYHYDCVVKWLNISGVCPICKKPLEQYVQELEEVKQNYQFY


>TTHERM_00295020(gene)
ATGTAAATCTAAATTCATGATCTTAGTTTGTAATTATTCTCAAAAATCACCATAAGAATC
AATTTTATTAAATATTTTTAAGCTGAATAAATCTCTATAAATAACAAAGTGATCAAATTC
TTCTTTAAATCTATAAAGAAGTAAATAGGAGAAAGTTTATAAAACTCCAAATTATAAAAG
CTACTTATCATATTATTATTTTATATCAGAATTCTTTTGAATAAAATTATTTAAATGTTG
AGTAGATTTCAAAGTTAATAGTAAAACCCTCAAAATAATTAGTAGGATAATAACATTTCA
TTTATCTCATATGAAAATGAGAGAGTAAGCATTTCTCAAAAAAACCTTGATAATACTATA
GATTATAAATCTAAATATTTACAAAAAAAATCAAGGAGTGAAAATTATTTTCCTCCACAG
AATTTTCTCTAAAATTTTTACTCTTAAACATCTTTAAAACACTATTTTATTTAAGAACAT
TATGCTTTTTTTTTGATAAAAAGCAATTTGAAATTATTTTAAGATTATATTTTTTAAAAG
GTAGCTGTAAGAAGAAATTTTTTGGAAAACCTTAAGGTGTCTCTTCACGAATCGTTTGTT
ACTAATATAGGATTAGTTTGCCTTTCTAGTTTGAAAATTACAGCAATCATTTTAGTTTTT
ATCTTAGAAAAAATACCAAAACTTGAAAACGGAAACCAAGATTTTTAAATAAATGAGAAG
CAATTATAAGGAGTGTATGAGATTAAGCTGTGGCTAATATTTATGATTGCATATGATGGA
CTGAATATATTTTACTTATTTTATACAATTTACATAATTGGTAAATACAATAAAGCTGCT
TATAGGAGAGGGTAAGGAGAAAATTCCTTATAAGATGGATAAATAATTTATAATGATCAG
CAGAGCTCTGCATATTTGCAAACTAATTAGATGATACAATCGTAAATAAGTCTTGATATG
GAATAAAATTTATATTAAAATGGTCAAAATGATATGATTAATGAACCTTTAAATGAGTAC
TACTATCAATAATATAGCTCGCCTTTATCAATTAACCACCAAATAAACTTTTTAGAATTA
GCAAGTAATAGGAATAAAGTATTAAAGTACAGCTCTCTAGCAACAAAAATGTAATAAATA
ATGATCTCATCAATAATAAATTTTTTCATTAATTAAAAATAGATCTTACTTAGTCTTGTT
CTTATTGGGAAACTATTTTGCATATATTAATAAAAGCTGTTCTAGTTAGTTCCCTTACCA
TTATTATCTACTCTTATGGCTTGTGGCACTAGTAATATTAATTTTATTCTAGGTTTGTAA
TAAATCTTTCTAATACTAAAATAAAAGGGATATTTTTCATTTGGAATATAAATTTTACTC
TTGCTTTCAATCTGTTTGTGCTTTCCATTAACATTATTCCTTTATGTTTTGATGAGAAAT
AGAACTAACTCTTCAATTCCGGCAAACAATGTAAAATAATAATATAATTAATAATTTGGC
TAAATAATAATATTTATATCAATAGGAAATTATAAAAAGACTATAACCATAAAAATACAA
AGACAAAATAAACAATTCAGAATTTGATACATAAAAAGAATGTTGCATTTGTCTGGTAGA
TTATTAATCTGACGATTTAATCATAAGTTTACCTTGCAGTAAATTGTAAGCCTTAAATAT
TCTAAATGTTTCTTTCATGTTAAAATTTTTTTTTTTTTAATTAGGCATCATTATCATTAT
GATTGTGTTGTTAAGTGGTTAAATATCAGTGGAGTCTGTCCTATATGCAAGAAACCTTTG
GAGTAATATGTTTAAGAATTAGAAGAAGTAAAGCAAAACTACCAATTCTATTGA