Identifiers and Description

Gene Model Identifier

TTHERM_00294790

Standard Name

None

Aliases

PreTt15589 | 27.m00249 | 3692.m00052

Description

eukaryotic translation initiation factor eIF2A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04702 ) Vicilin N terminal region
  • ( PF08662 ) Eukaryotic translation initiation factor eIF2A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00294790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08736.19.997093137033517e-262hypothetical protein (638 aa)
DictyBaseDDB_G02842671.0003292389192957e-45eIF2a on chromosome: 4 positio
n 1799493 to 1801319
OxytrichaContig1669.0.g927.999101194912153e-45Eukaryotic translation initiat
ion factor eIF2A
SGDYGR054W9.99893167504554e-35YGR054W Eukaryotic initiation
factor (eIF) 2A; associates sp
ecifically with both 40S subun
its and 80 S ribosomes, and in
teracts genetically with both
eIF5b and eIF4E; homologous to
mammalian eIF2A
WormBaseWBGene000084802.000470901975128e-28Eukaryotic translation initiat
ion factor 2A status:Confirm
ed UniProt:Q19052 protein_
id:CAA91279.2
Stentor CoeruleusSteCoe_96882.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00294790(coding)
ATGTTGCTGATTTTGAGTAAATGTTAGAACAATTTTCAAAAACTCTAATATTTAGTTAAG
CAGATAATTTAAATAGTGGACCATCATTATAAATTTTTGTATCTTCAGAATATAAATCTA
ATATTTTTTATAAATTTTTTAGATAGATCACTTGGCAATCTATAAATTATAAAAACCTAA
TTATCATAAAATTTGATTCACATATCTACCTCTTTAATTTCAAAAAATAAATAAAGCAAA
ACAAAATATAAATAAACACATAACCAAAAAATGTCAGGCTGGGACGATTTTTAAGAACTT
CCTCAATAACCAAATCAAAAGAATAATCAAAATAGGAACCAAAATAATTAAAACAAAAAT
AACTACAACAATAACAATCGTAATTCTAATAATAACAACAATAGAAACTATAACAACAAT
ATCAGCTCTTAGCAAAATTAAGGAAGCAATCAAGGATACAAATAATAGCAAAAGCCCGTT
TATGTTGAAAAACAAGAAGATTAACCAAGAAGATTTTAGTTTTTTAATAGCAGCAAAAAT
AAACCTGATTAACAAAAAGATAACATACCTTAGGATTAAGTAGAGGAGAAAAAAGTTAAC
TCAGAAAATACCCAAGTTGAAAGCTCTAGTTAAAAGTAAGTTTCCTAGTTGCCTACATTA
TCATCTGTTTAATAGTAGTAGTAGCAATAGCCATAATAGTAGTAATAGCAACAGTAAGCT
ACTAAAGTATACGAAGTAGTAAATGCTAACTACAATGCTCCTCATAAAATCCTAATCAGA
TCAAAAGAAGGAATTTATGAGACAAGTTGTTATTCTTAATCTATGATTAATGAAAAAAAG
GTTTTAACAGGACCAGCAGATTTTATGTGTCTATCAAAAGACGAGCAATATATTTTAGTA
ACTTTAGATACAGTAGTTAAGGTCATTAAAATTAGCGACAACTCAGTTGTTAGCTAAAGA
GAATTTGTTTCTATCAAACACACTAATCTTTCTTAGAACAATAAATACATTTAGGTTTTG
GACAGAATTGACAACAACAAATACACTTCATATGTCTTCTCCTTCCCCGATTTTAAGCTT
TTGAAAGAATTCAATGAGAAGAGATACATTAAGGAAAACGCTCCTTATGTTAAATTTAAT
AAATAAGAGACAAAAGCTTTTTATTACAATTACTCCACTGGGTTCATTGAAGTATATGAA
ACACCTGATTTTTCCAAAATTGTTTAGTAAGCAGAAATGTAAAACTTAGATTTCTTCTAA
GTATCACCTGAACATGATTTTATTGTTGGTTGTTTCCTTGAACATATGGTAGGTTATGAA
AAGACTCAAGCTAAATTATAATTTTATAACTTGGAAAAAGATAAGAGAGAAAAAGTGAAA
AATATTGAAAAAGCTTAAGAAATTAATATAAAATGGTCACCTGATGGTAACAATTGTATA
TTGACTACTTAAACAATTCACGATTCTACAGGTAATACTTATTATGGTTAAACTGCCTTG
TGGAGATATCAATTTGGTAAAAAATACCTTCACCAAATTCCAACTATTGATGGCCCTGTC
CATGATGTTGATTGGCATCCTAACGGAGAATAGTTTATTGCTATTGTTGGTTATATGCCT
GCAAAGCCTATTCTTTACAATCTCCGTTGCGAGCCCTTATTTTCATTTGGTACAATGCAC
AGAAATACTATTCGTTTCTAGCCATAAGGAAGATTTGTACTTTTTGGTGGTTTTGGTAAT
ATTTCTGGTGATGTTGATGTTTGGGAGTTAAATTCATTAGAAAAATTAGCTAAATTTAAT
TCAAATACCTCAGCTTCTATCGAATGGTCATTAGATGGAAAACACATTTTGACTGGAGTT
CTTACCCCAAGATTAAGAGTTGACAATAACTTTAAATTATTTAAATGGAATGGTGAACTC
ATTAATACTTGTAATTTCTCTCATACTGAATTGTATGAAGTTGTTTGGAAAAAGAATTAA
CAGTATACTGATATGACACCTATTCCTGAAAACGAAATTACTAATGAATTGAACAAACAG
AGACAAATCACTAAATCTTAAACCAGTAAGAGACCTTTATTCGGAGGTGGATCATTTGCC
GAAAGTCTTAGAAATGAAAGAGGTGAAGAAGGCCCAAAGAAGTTAACTGGAGAAGAAGAG
TGGGTGATAAAGGCAAAAAATGAAGCCAAAAAAAATAATAAATGA


>TTHERM_00294790(protein)
MLLILSKCQNNFQKLQYLVKQIIQIVDHHYKFLYLQNINLIFFINFLDRSLGNLQIIKTQ
LSQNLIHISTSLISKNKQSKTKYKQTHNQKMSGWDDFQELPQQPNQKNNQNRNQNNQNKN
NYNNNNRNSNNNNNRNYNNNISSQQNQGSNQGYKQQQKPVYVEKQEDQPRRFQFFNSSKN
KPDQQKDNIPQDQVEEKKVNSENTQVESSSQKQVSQLPTLSSVQQQQQQQPQQQQQQQQA
TKVYEVVNANYNAPHKILIRSKEGIYETSCYSQSMINEKKVLTGPADFMCLSKDEQYILV
TLDTVVKVIKISDNSVVSQREFVSIKHTNLSQNNKYIQVLDRIDNNKYTSYVFSFPDFKL
LKEFNEKRYIKENAPYVKFNKQETKAFYYNYSTGFIEVYETPDFSKIVQQAEMQNLDFFQ
VSPEHDFIVGCFLEHMVGYEKTQAKLQFYNLEKDKREKVKNIEKAQEINIKWSPDGNNCI
LTTQTIHDSTGNTYYGQTALWRYQFGKKYLHQIPTIDGPVHDVDWHPNGEQFIAIVGYMP
AKPILYNLRCEPLFSFGTMHRNTIRFQPQGRFVLFGGFGNISGDVDVWELNSLEKLAKFN
SNTSASIEWSLDGKHILTGVLTPRLRVDNNFKLFKWNGELINTCNFSHTELYEVVWKKNQ
QYTDMTPIPENEITNELNKQRQITKSQTSKRPLFGGGSFAESLRNERGEEGPKKLTGEEE
WVIKAKNEAKKNNK


>TTHERM_00294790(gene)
ATGTTGCTGATTTTGAGTAAATGTTAGAACAATTTTCAAAAACTCTAATATTTAGTTAAG
CAGATAATTTAAATAGTGGACCATCATTATAAATTTTTGTATCTTCAGAATATAAATCTA
ATATTTTTTATAAATTTTTTAGATAGATCACTTGGCAATCTATAAATTATAAAAACCTAA
TTATCATAAAATTTGATTCACATATCTACCTCTTTAATTTCAAAAAATAAATAAAGCAAA
ACAAAATATAAATAAACACATAACCAAAAAATGTCAGGCTGGGACGATTTTTAAGAACTT
CCTCAATAACCAAATCAAAAGAATAATCAAAATAGGAACCAAAATAATTAAAACAAAAAT
AACTACAACAATAACAATCGTAATTCTAATAATAACAACAATAGAAACTATAACAACAAT
ATCAGCTCTTAGCAAAATTAAGGAAGCAATCAAGGATACAAATAATAGCAAAAGCCCGTT
TATGTTGAAAGTAATTAATTTTTATACTAAAATATTTTATTAATGATTTGAAAAATAACT
TTTCTTAATATAGAACAAGAAGATTAACCAAGAAGATTTTAGTTTTTTAATAGCAGCAAA
AATAAACCTGATTAACAAAAAGATAACATACCTTAGGATTAAGTAGAGGAGAAAAAAGTT
AACTCAGAAAATACCCAAGTTGAAAGCTCTAGTTAAAAGTAAGTTTCCTAGTTGCCTACA
TTATCATCTGTTTAATAGTAGTAGTAGCAATAGCCATAATAGTAGTAATAGCAACAGTAA
GCTACTAAAGTATACGAAGTAGTAAATGCTAACTACAATGCTCCTCATAAAATCCTAATC
AGATCAAAAGAAGGAATTTATGAGACAAGTTGTTATTCTTAATCTATGATTAATGAAAAA
AAGGTTTTAACAGGACCAGCAGATTTTATGTGTCTATCAAAAGACGAGCAATATATTTTA
GTAACTTTAGATACAGTAGTTAAGGTCATTAAAATTAGCGACAACTCAGTTGTTAGCTAA
AGAGAATTTGTTTCTATCAAACACACTAATCTTTCTTAGAACAATAAATACATTTAGGTT
TTGGACAGAATTGACAACAACAAATACACTTCATATGTCTTCTCCTTCCCCGATTTTAAG
CTTGTATAATCTTATACATTTGCCAAAAAATTATTAAATATTTTAATATTTGATATTTTT
TTTCAGCTAGACAACAAATTACTTACTATATTTTTAAAAATAGTTGAAAGAATTCAATGA
GAAGAGATACATTAAGGAAAACGCTCCTTATGTTAAATTTAATAAATAAGAGACAAAAGC
TTTTTATTACAATTACTCCACTGGGTTCATTGAAGTATATGAAACACCTGATTTTTCCAA
AATTGTTTAGTAAGCAGAAATGTAAAACTTAGATTTCTTCTAAGTATCACCTGAACATGA
TTTTATTGTTGGTTGTTTCCTTGAAGTAAATAATATTTGAACTCATTAATTAATATATTA
ACTGATTGTTTATAGCATATGGTAGGTTATGAAAAGACTCAAGCTAAATTATAATTTTAT
AACTTGGAAAAAGATAAGAGAGAAAAAGTGAAAAATATTGAAAAAGCTTAAGAAATTAAT
ATAAAATGGTCACCTGATGGTAACAATTGTATATTGACTACTTAAACAATTCACGATTCT
ACAGGTAATACTTATTATGGTTAAACTGCCTTGTGGAGATATCAATTTGGTAAAAAATAC
CTTCACCAAATTCCAACTATTGATGTAATACATTTTCATATTTGCTTAACTTAATGAAAT
TCATTTTAAATTTATTAATTAATTTTTTAAAAATTATTTTAAATTATTTTAGGGCCCTGT
CCATGATGTTGATTGGCATCCTAACGGAGAATAGTTTATTGCTATTGTTGGTTATATGCC
TGCAAAGCCTATTCTTTACAATCTCCGTTGCGAGCCCTTATTTTCATTTGGTACAATGCA
CAGAAATACTATTCGTTTCTAGCCATAAGGAAGATTTGTACTTTTTGGTGGTTTTGGTAA
TATTTCTGGTGATGTTGATGTTTGGGAGTTAAATTCATTAGAAAAATTAGCTAAATTTAA
TTCAAATACCTCAGCTTCTATCGAATGGTCATTAGATGGAAAACACGTATTTATTAAAAT
TTCTTCAATATTTAATAATAAATATTTTTTTTATTAATGAATAATCAGATTTTGACTGGA
GTTCTTACCCCAAGATTAAGAGTTGACAATAACTTTAAATTATTTAAATGGAATGGTGAA
CTCATTAATACTTGTAATTTCTCTCATACTGAATTGTATGAAGTTGTTTGGAAAAAGAAT
TAACAGTATACTGATATGACACCTATTCCTGAAAACGAAATTACTAATGAATTGAACAAA
CAGAGACAAATCACTAAATCTTAAACCAGTAAGAGACCTTTATTCGGAGGTGGATCATTT
GCCGAAAGTCTTAGAAATGAAAGAGGTGAAGAAGGCCCAAAGAAGTTAACTGGAGAAGAA
GAGTGGGTGATAAAGGCAAAAAATGAAGCCAAAAAAAATAATAAATGA