Identifiers and Description

Gene Model Identifier

TTHERM_00294550

Standard Name

None

Aliases

PreTt15565 | 27.m00225 | 3692.m00028

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00098 ) Zinc knuckle
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF08208 ) Yeast RNA polymerase I subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00294550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08711.19.997093137033517e-262hypothetical protein (576 aa)
OxytrichaContig15038.0.g531.0003292389192957e-45WD domain, G-beta repeat
DictyBaseDDB_G02753239.997441244797434e-45tipD on chromosome: 2 position
5406103 to 5408018
WormBaseWBGene000194271.0002124404074584e-26locus:atg-16.2 Autophagic-re
lated protein 16.2 status:Pa
rtially_confirmed UniProt:Q0
9406 protein_id:CCD72613.1
SGDYCR072C0.000000000000001999258566166494RSA4 WD-repeat protein involve
d in ribosome biogenesis; may
interact with ribosomes; requi
red for maturation and efficie
nt intra-nuclear transport or
pre-60S ribosomal subunits, lo
calizes to the nucleolus
Stentor CoeruleusSteCoe_87330.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00294550(coding)
ATGTCTACAACTATCAAAAAAAAAGTTTTTAACTAAAATCAAATTCTCAATTAATTAAGA
AGCTTTAGTGGTAAAGTTAAAGAAATAGATGAAGTCATCACTTTGTATGAATAAGGCATG
ACTTACTTTAACAATTAATCTAAAAAATTTTTTTAGTTTGGAGCCAATGAAATTATATAG
AGAGATGATTACAGATTAGAACTTGATTCAAATGAAAACTATTTTAACAAAAGTCCTTCA
ATGAGTTAAGACATGTATGATACCCAAAACCAATTATAGGAAAGATCAAAGTCATTAAGT
TAAAACTATTAAAAAAAAGATAGCACACCTCCTTAGCAGTATTAATAATAAAATCCAGGA
TCATAGAATACTATTTTCTAGTTAAAATAAAAAGTAAAATAATTAGAATAGTAAGGCAAT
TAGCTAAGAGAGCAAAATGAATGTCTATCTGCTGATCTAAAAGTTAAATCCCACGATCTT
GAGGAGTTAAAAAACTAATTAGATATTTTAGTAGAGCAAAATTCTAAGCAAAAGCAAAAT
ATTTATGAAAAAGATGATTTGATTGCTAAGCAGGCAGCAGAAATAAAAAAGCTTAATGAA
ATAGAAATTAAGCATGTAGAAGCTATACAAACTATAAAAGATTAATTAGAAAAAAAAATA
GAATAAATTACTATAGTTGAAGCAGATAGAAATCAATTATTAGAAAGATATTTACTTGAA
AAAACATAGTTTGCAGAAAAAATGAATTAATTAAATACTTTGTAGGAAGAACTTAATTAC
AAGATGAGTAAGCTATCAGAGGATGAAGAATACCTCATTAAACGTAAATTAAATTTTTAA
ACGGAAATTTAGAAGAGTGGTATAAAAATGCCTACATTAGCACCAACTATTGATGAATCA
AAGATTAATCTTTAATAGAGTGAAGTTCCTTCGAAACCTACTAAAGTTCTATTAAAATAG
CATAAAAACGAGATATATTGCATTGGTTAGTCTTTAAATGGATCATTAATTGCATCGTGT
GGTGGAGATAATTTTATTAAGCTATATGATCCACTTAGTATGAATCAGTAAGGATAGTTA
CAGTCTCCAAGAGATGATATATTATTTCTTCATTTGAATTTTGCTCCTTTTTCAGAGCTT
ATACTAGCAGGTCTCACCGATAAAACAATGTAACTTTTTAATTACTCTACAAGCAAGCTT
AAATCTACATTCTAAGGACATAATGAAAGAGTTAATGTTGTTTCATTTACTTCAGAAAAA
GAAAAAGTAGTAAGTGGTTCTACAGACAGAAGTTTGAAGATTTGGGATGTAAATAAAGTT
TCTTAAATTAAAAGTATTTTGTGTGGATCAATTATGAGAGCTATTGATTACTTTTAAAGC
GAGCCTCATATTGTTTCTGGTCATAATGATGGTTCAATACGTTTATATTCTATTCGTGAC
TCTAATAACACAAAGCCAGTGTATAATGTATAGGGTGTATTTGAAAACGGAGTTACATGT
GTTAAAATTTCTAATTGTCAGAATTATATCTTAGCTTCAAGTGCTGAAGGGTTTACCTTA
AAAGTAGTTGATTTACGTAAAAATTAGGTTGTCAAAACATTTGAAAATCAATAGTACTTT
AATAATCATGAGTTTAACAAATGTTGCTTTGGACCTGATGATAAGTATATTATTGCAGGA
AGTTCAGACAGCTCTATTATCATGTTTAATTTCAAAGATGGTACTAAAAAATCAGTTCTT
AAAAATTAGAATCACTAAGGTGTTATTGTTGCAGTGGACTATCATAATGTTTCTGGTAAT
TTGTATTCTGGTGATAGCAGAGGAAACCTACTTATATGGAATTGA


>TTHERM_00294550(protein)
MSTTIKKKVFNQNQILNQLRSFSGKVKEIDEVITLYEQGMTYFNNQSKKFFQFGANEIIQ
RDDYRLELDSNENYFNKSPSMSQDMYDTQNQLQERSKSLSQNYQKKDSTPPQQYQQQNPG
SQNTIFQLKQKVKQLEQQGNQLREQNECLSADLKVKSHDLEELKNQLDILVEQNSKQKQN
IYEKDDLIAKQAAEIKKLNEIEIKHVEAIQTIKDQLEKKIEQITIVEADRNQLLERYLLE
KTQFAEKMNQLNTLQEELNYKMSKLSEDEEYLIKRKLNFQTEIQKSGIKMPTLAPTIDES
KINLQQSEVPSKPTKVLLKQHKNEIYCIGQSLNGSLIASCGGDNFIKLYDPLSMNQQGQL
QSPRDDILFLHLNFAPFSELILAGLTDKTMQLFNYSTSKLKSTFQGHNERVNVVSFTSEK
EKVVSGSTDRSLKIWDVNKVSQIKSILCGSIMRAIDYFQSEPHIVSGHNDGSIRLYSIRD
SNNTKPVYNVQGVFENGVTCVKISNCQNYILASSAEGFTLKVVDLRKNQVVKTFENQQYF
NNHEFNKCCFGPDDKYIIAGSSDSSIIMFNFKDGTKKSVLKNQNHQGVIVAVDYHNVSGN
LYSGDSRGNLLIWN


>TTHERM_00294550(gene)
ATGTCTACAACTATCAAAAAAAAAGTTTTTAACTAAAATCAAATTCTCAATTAATTAAGA
AGCTTTAGTGGTAAAGTTAAAGAAATAGATGAAGTCATCACTTTGTATGAATAAGGCATG
ACTTACTTTAACAATTAATCTAAAAAATTTTTTTAGTTTGGAGCCAATGAAATTATATAG
AGAGATGATTACAGATTAGAACTTGATTCAAATGAAAACTATTTTAACAAAAGTCCTTCA
ATGAGTTAAGACATGTATGATACCCAAAACCAATTATAGGAAAGATCAAAGTCATTAAGT
TAAAACTATTAAAAAAAAGATAGCACACCTCCTTAGCAGTATTAATAATAAAATCCAGGA
TCATAGAATACTATTTTCTAGTTAAAATAAAAAGTAAAATAATTAGAATAGTAAGGCAAT
TAGCTAAGAGAGCAAAATGAATGTCTATCTGCTGATCTAAAAGTTAAATCCCACGATCTT
GAGGAGTTAAAAAACTAATTAGATATTTTAGTAGAGCAAAATTCTAAGCAAAAGCAAAAT
ATTTATGAAAAAGATGATTTGATTGCTAAGCAGGCAGCAGAAATAAAAAAGCTTAATGAA
ATAGAAATTAAGCATGTAGAAGCTATACAAACTATAAAAGATTAATTAGAAAAAAAAATA
GAATAAATTACTATAGTTGAAGCAGATAGAAATCAATTATTAGAAAGATATTTACTTGAA
AAAACATAGTTTGCAGAAAAAATGAATTAATTAAATACTTTGTAGGAAGAACTTAATTAC
AAGATGAGTAAGCTATCAGAGGATGAAGAATACCTCATTAAACGTAAATTAAATTTTTAA
ACGGAAATTTAGAAGAGTGGTATAAAAATGCCTACATTAGCACCAACTATTGATGAATCA
AAGATTAATCTTTAATAGAGTGAAGTTCCTTCGAAACCTACTAAAGTTCTATTAAAATAG
CATAAAAACGAGATATATTGCATTGGTTAGTCTTTAAATGGATCATTAATTGCATCGTGT
GGTGGAGATAATTTTATTAAGCTATATGATCCACTTAGTATGAATCAGTAAGGATAGTTA
CAGTCTCCAAGAGATGATATATTATTTCTTCATTTGAATTTTGCTCCTTTTTCAGAGCTT
ATACTAGCAGGTCTCACCGATAAAACAATGTAACTTTTTAATTACTCTACAAGCAAGCTT
AAATCTACATTCTAAGGACATAATGAAAGAGTTAATGTTGTTTCATTTACTTCAGAAAAA
GAAAAAGTAGTAAGTGGTTCTACAGACAGAAGTTTGAAGATTTGGGATGTAAATAAAGTT
TCTTAAATTAAAAGTATTTTGTGTGGATCAATTATGAGAGCTATTGATTACTTTTAAAGC
GAGCCTCATATTGTTTCTGGTCATAATGATGGTTCAATACGTTTATATTCTATTCGTGAC
TCTAATAACACAAAGCCAGTGTATAATGTATAGGGTGTATTTGAAAACGGAGTTACATGT
GTTAAAATTTCTAATTGTCAGAATTATATCTTAGCTTCAAGTGCTGAAGGGTTTACCTTA
AAAGTAGTTGATTTACGTAAAAATTAGGTTGTCAAAACATTTGAAAATCAATAGTACTTT
AATAATCATGAGTTTAACAAATGTTGCTTTGGACCTGATGATAAGTATATTATTGCAGGA
AGTTCAGACAGCTCTATTATCATGTTTAATTTCAAAGATGGTACTAAAAAATCAGTTCTT
AAAAATTAGAATCACTAAGGTGTTATTGTTGCAGTGGACTATCATAATGTTTCTGGTAAT
TTGTATTCTGGTGATAGCAGAGGAAACCTACTTATATGGAATTGA