Identifiers and Description

Gene Model Identifier

TTHERM_00289080

Standard Name

None

Aliases

PreTt25940 | 26.m00292 | 3688.m00085

Description

Pyridoxal-dependent decarboxylase conserved domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00282 ) pyridoxal-dependent decarboxylase conserved domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09315.19.99709313703352e-262pyridoxal-dependent decarboxyl
ase domain-containing protein
(503 aa)
WormBaseWBGene000067621.00036029423542e-110locus:unc-25 status:Confirme
d UniProt:G5EDB7 protein_i
d:CAA21537.1
DictyBaseDDB_G02828192.99969482341167e-06sglA on chromosome: 3 position
6335773 to 6337539
SGDYDR294C0.00020003864201578DPL1 Dihydrosphingosine phosph
ate lyase, regulates intracell
ular levels of sphingolipid lo
ng-chain base phosphates (LCBP
s), degrades phosphorylated lo
ng chain bases, prefers C16 di
hydrosphingosine-l-phosphate a
s a substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00289080(coding)
ATGGAACAATAAGATTAGCATCTTTTAGCAAATGATAAAAAACTCAATGAGAAATTTCTG
GATGATGTTTTTTAGATTTTGAAGAAGATAATTCTCGAATGCAAGACAGGTAATGGAAAG
GTTATTGACTTTAAGACTCCTGATTAGCTCATTAAAGAAATAGATTTAACTCTTCCTTTA
AAAGGATAGTCTGATGAAGAGATTATTAACTTCATTAAATTAGTTGACAAATATAGCGTT
AAGACTTCACACTCTCACTTTTTCAATAACCTCTTCGGTGGTTCAAATGAATATTCTTTA
GCAGGAGACTATTTCACATCTACAATTAATGGCTCTATGTATACTTATGAAATGGCCCCA
GTTTTTAACTTTATGGAAAACGCCATTTAGTAATTATTTGCAGAAAGATACTTAAAGTGG
AGTACAATTGATGGAGTTTTCTGCCCAGGCGGTTCCTAATCTAATTTTTATGGTATCTTA
GCAGCTAGATAACACAAATATCCTGAATTTAAGAGAAAAGGTCTTCGTGCTCTTCCTGAT
TTGAAACTTTTCACATCTGAATTAGCTCACTATAGCATCGAAAAAGGAGCAATTATGCTT
GGTTTTGGTCTTGATTCTGTTGTCAAAATAGCTTGTGATGAAGAAGGAAGAATGATTCCT
GAGGAATTCGAAAAGGAAATCTAAAAATGCATTTAAGAAGGTTCAGTTCCTTTAATGGTT
AATTTGACCTGTGGTACAACAGTCTTTGGTGTAGTTGATCCTATCAACAAATGCACTGAA
ATAGCACAAAAATATAACATGTGGGTTCACATTGATGGCTGTTGGGGTGGTCACTTGATC
TTTTTAGAAGAATTTAGAAATAAATATAGCCTCATCAGCTAAGCTGATAGTTTCGCTTGG
GATGCTCATAAATTATTTAATGTTCCTTAATAATGTACAGCCTTTTTCACTAGACATGTT
GGCTTGCTTCATGAAGCTAATGCTTTAGGTAGCGACTATCTTTTCATGAAGGACAAAAAA
CTCTATGATGCAACTAAATATGATTCAGGAGATAAGACTTACTAATGTGCAAGACATATA
GATGTATTCAAATTTTGGATCTACTGGAAACATTTTGGTACATTAGGTTTAGAATAAATT
GTTGCTGATTCTTTAGAAACCACTAAATATTTTGCCTAGTTGGTTAAAGATCACCCTAAC
TGTGAATTAATCAATGAGCCTGAATATGTTAGTGTCAGCTTTTTCTATTATCCTGACTCA
TTCTTAAAAAGAAAAGAATTAGGAGAAGACAAAACAGAAAAATTCTGGGAAGACATGCAT
AATATTCCTCCTATCATCAAAGCTAAAATGGTTGAGCAAGGTACAATGATGGTTGCCTAT
TAAAAACAAAACCAAAAATCAATTCAAAGAAAGAACTTCTTCAGATTTATCTTTACAGCT
GATAAAGGAAAAGAAGAAGCATAATTTGCTCTTAATGAAATACACAGATTGGGTAAAGAT
TTATGA


>TTHERM_00289080(protein)
MEQQDQHLLANDKKLNEKFLDDVFQILKKIILECKTGNGKVIDFKTPDQLIKEIDLTLPL
KGQSDEEIINFIKLVDKYSVKTSHSHFFNNLFGGSNEYSLAGDYFTSTINGSMYTYEMAP
VFNFMENAIQQLFAERYLKWSTIDGVFCPGGSQSNFYGILAARQHKYPEFKRKGLRALPD
LKLFTSELAHYSIEKGAIMLGFGLDSVVKIACDEEGRMIPEEFEKEIQKCIQEGSVPLMV
NLTCGTTVFGVVDPINKCTEIAQKYNMWVHIDGCWGGHLIFLEEFRNKYSLISQADSFAW
DAHKLFNVPQQCTAFFTRHVGLLHEANALGSDYLFMKDKKLYDATKYDSGDKTYQCARHI
DVFKFWIYWKHFGTLGLEQIVADSLETTKYFAQLVKDHPNCELINEPEYVSVSFFYYPDS
FLKRKELGEDKTEKFWEDMHNIPPIIKAKMVEQGTMMVAYQKQNQKSIQRKNFFRFIFTA
DKGKEEAQFALNEIHRLGKDL


>TTHERM_00289080(gene)
ATGGAACAATAAGATTAGCATCTTTTAGCAAATGGTAACTATTGGTTCAAAAAAATATTT
TATATTTAAATCCTTTAATATTTATCAGATAAAAAACTCAATGAGAAATTTCTGGATGAT
GTTTTTTAGATTTTGAAGAAGATAATTCTCGAATGCAAGACAGGTAATGGAAAGGTTATT
GACTTTAAGACTCCTGATTAGCTCATTAAAGAAATAGATTTAACTCTTCCTTTAAAAGGA
TAGTCTGATGAAGAGATTATTAACTTCATTAAATTAGTTGACAAATATAGCGTTAAGACT
TCACACTCTCACTTTTTCAATAACCTCTTCGGTGGTTCAAATGAATATTCTTTAGCAGGA
GACTATTTCACATCTACAATTAATGGCTCTATGTATACTTATGAAATGGCCCCAGTTTTT
AACTTTATGGAAAACGCCATTTAGTAATTATTTGCAGAAAGATACTTAAAGTGGAGTACA
ATTGATGGAGTTTTCTGCCCAGGCGGTTCCTAATCTAATTTTTATGGTATCTTAGCAGCT
AGATAACACAAATATCCTGAATTTAAGAGAAAAGGTCTTCGTGCTCTTCCTGATTTGAAA
CTTTTCACATCTGAATTAGCTCACTATAGCATCGAAAAAGGAGCAATTATGCTTGGTTTT
GGTCTTGATTCTGTTGTCAAAATAGCTTGTGATGAAGAAGGAAGAATGATTCCTGAGGAA
TTCGAAAAGGAAATCTAAAAATGCATTTAAGAAGGTTCAGTAAGATAGACAATTATTTAT
TTTGCTTGAAGAAAATGAATTAAATAAATAAAAACCGAAGATAAATAAATAAACATATAA
AACAAAACTTATTTGAATCTGCTAAAATATTTTATAATTTCATTTTATTTTTAAAGATAT
TTTTTTAGTTCATAAAGAAAAAGCAGTATCCAAATGTAAAAATTTTATGATAAAAGATAT
TTTTTGATAGCTTTTATCAAAATTATTAACTAAAATACGTAATATTCATCAATAATATTT
ATTCTTTTATTAATCTAATTTAGGTTCCTTTAATGGTTAATTTGACCTGTGGTACAACAG
TCTTTGGTGTAGTTGATCCTATCAACAAATGCACTGAAATAGCACAAAAATATAACATGT
GGGTTCACATTGATGGCTGTTGGGGTGGTCACTTGATCTTTTTAGAAGAATTTAGAAATA
AATATAGCCTCATCAGCTAAGCTGATAGTTTCGCTTGGGATGCTCATAAATTATTTAATG
TTCCTTAATAATGTACAGCCTTTTTCACTAGACATGTTGGCTTGCTTCATGAAGCTAATG
CTTTAGGTAGCGACTATCTTTTCATGAAGGACAAAAAACTCTATGATGCAACTAAGTAAT
AAAATAAATTAAAAAATTAATATTTCATCTATTAATCAATACTTTCTTTAATAAAGATAT
GATTCAGGAGATAAGACTTACTAATGTGCAAGACATATAGATGTATTCAAATTTTGGATC
TACTGGAAACATTTTGGTACATTAGGTTTAGAATAAATTGTTGCTGATTCTTTAGAAACC
ACTAAATATTTTGCCTAGTTGGTTAAAGATCACCCTAACTGTGAATTAATCAATGAGCCT
GAATATGTTAGTGTCAGCTTTTTCTATTATCCTGACTCATTCTTAAAAAGAAAAGAATTA
GGAGAAGACAAAACAGAAAAATTCTGGGAAGACATGCATAATATTCCTCCTATCATCAAA
GCTAAAATGGTTGAGCAAGGTACAATGATGGTTGCCTATTAAAAACAAAACCAAAAATCA
ATTCAAAGAAAGAACTTCTTCAGATTTATCTTTACAGCTGATAAAGGAAAAGAAGAAGCA
TAATTTGCTCTTAATGAAATACACAGATTGGGTAAAGATTTATGA