Identifiers and Description

Gene Model Identifier

TTHERM_00289080

Standard Name

None

Aliases

PreTt25940 | 26.m00292 | 3688.m00085

Description

Pyridoxal-dependent decarboxylase conserved domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00282 ) pyridoxal-dependent decarboxylase conserved domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09315.19.99709313703352e-262pyridoxal-dependent decarb...
IPI(HUMAN)IPI:IPI00292646.11.00009439685371e-101 1|TREMBL:Q53TQ7|ENSEMBL:ENSP0
0000350928|REFSEQ:NP_000808 |H
-INV:HIT000040213|VEGA:OTTHUMP
00000041054 Tax_Id=9606 Splice
Isoform 1 of Glutamate decarb
oxylase 1
FlyBaseFBgn00045162.00053300678404e-93
WormBaseY37D8A.23a1.00048830265696e-88WBGene00006762 unc-25 Pyridoxa
l-dependent decarboxylase cons
erved domain
TAIRAT4G286803.00026872567327e-20tyrosine decarboxylase, putati
ve
ParameciumDBGSPATP000351890011.99940758651679e-10Paramecium tetraurelia GSPATP0
0035189001 protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00289080(coding)
ATGGAACAATAAGATTAGCATCTTTTAGCAAATGATAAAAAACTCAATGAGAAATTTCTG
GATGATGTTTTTTAGATTTTGAAGAAGATAATTCTCGAATGCAAGACAGGTAATGGAAAG
GTTATTGACTTTAAGACTCCTGATTAGCTCATTAAAGAAATAGATTTAACTCTTCCTTTA
AAAGGATAGTCTGATGAAGAGATTATTAACTTCATTAAATTAGTTGACAAATATAGCGTT
AAGACTTCACACTCTCACTTTTTCAATAACCTCTTCGGTGGTTCAAATGAATATTCTTTA
GCAGGAGACTATTTCACATCTACAATTAATGGCTCTATGTATACTTATGAAATGGCCCCA
GTTTTTAACTTTATGGAAAACGCCATTTAGTAATTATTTGCAGAAAGATACTTAAAGTGG
AGTACAATTGATGGAGTTTTCTGCCCAGGCGGTTCCTAATCTAATTTTTATGGTATCTTA
GCAGCTAGATAACACAAATATCCTGAATTTAAGAGAAAAGGTCTTCGTGCTCTTCCTGAT
TTGAAACTTTTCACATCTGAATTAGCTCACTATAGCATCGAAAAAGGAGCAATTATGCTT
GGTTTTGGTCTTGATTCTGTTGTCAAAATAGCTTGTGATGAAGAAGGAAGAATGATTCCT
GAGGAATTCGAAAAGGAAATCTAAAAATGCATTTAAGAAGGTTCAGTTCCTTTAATGGTT
AATTTGACCTGTGGTACAACAGTCTTTGGTGTAGTTGATCCTATCAACAAATGCACTGAA
ATAGCACAAAAATATAACATGTGGGTTCACATTGATGGCTGTTGGGGTGGTCACTTGATC
TTTTTAGAAGAATTTAGAAATAAATATAGCCTCATCAGCTAAGCTGATAGTTTCGCTTGG
GATGCTCATAAATTATTTAATGTTCCTTAATAATGTACAGCCTTTTTCACTAGACATGTT
GGCTTGCTTCATGAAGCTAATGCTTTAGGTAGCGACTATCTTTTCATGAAGGACAAAAAA
CTCTATGATGCAACTAAATATGATTCAGGAGATAAGACTTACTAATGTGCAAGACATATA
GATGTATTCAAATTTTGGATCTACTGGAAACATTTTGGTACATTAGGTTTAGAATAAATT
GTTGCTGATTCTTTAGAAACCACTAAATATTTTGCCTAGTTGGTTAAAGATCACCCTAAC
TGTGAATTAATCAATGAGCCTGAATATGTTAGTGTCAGCTTTTTCTATTATCCTGACTCA
TTCTTAAAAAGAAAAGAATTAGGAGAAGACAAAACAGAAAAATTCTGGGAAGACATGCAT
AATATTCCTCCTATCATCAAAGCTAAAATGGTTGAGCAAGGTACAATGATGGTTGCCTAT
TAAAAACAAAACCAAAAATCAATTCAAAGAAAGAACTTCTTCAGATTTATCTTTACAGCT
GATAAAGGAAAAGAAGAAGCATAATTTGCTCTTAATGAAATACACAGATTGGGTAAAGAT
TTATGA


>TTHERM_00289080(protein)
MEQQDQHLLANDKKLNEKFLDDVFQILKKIILECKTGNGKVIDFKTPDQLIKEIDLTLPL
KGQSDEEIINFIKLVDKYSVKTSHSHFFNNLFGGSNEYSLAGDYFTSTINGSMYTYEMAP
VFNFMENAIQQLFAERYLKWSTIDGVFCPGGSQSNFYGILAARQHKYPEFKRKGLRALPD
LKLFTSELAHYSIEKGAIMLGFGLDSVVKIACDEEGRMIPEEFEKEIQKCIQEGSVPLMV
NLTCGTTVFGVVDPINKCTEIAQKYNMWVHIDGCWGGHLIFLEEFRNKYSLISQADSFAW
DAHKLFNVPQQCTAFFTRHVGLLHEANALGSDYLFMKDKKLYDATKYDSGDKTYQCARHI
DVFKFWIYWKHFGTLGLEQIVADSLETTKYFAQLVKDHPNCELINEPEYVSVSFFYYPDS
FLKRKELGEDKTEKFWEDMHNIPPIIKAKMVEQGTMMVAYQKQNQKSIQRKNFFRFIFTA
DKGKEEAQFALNEIHRLGKDL


>TTHERM_00289080(gene)
AAAAATTAATTATTGTTAAATAAAGGTAAATATATAGTTTAGAATATCATACAAATAAGA
ATGGAACAATAAGATTAGCATCTTTTAGCAAATGGTAACTATTGGTTCAAAAAAATATTT
TATATTTAAATCCTTTAATATTTATCAGATAAAAAACTCAATGAGAAATTTCTGGATGAT
GTTTTTTAGATTTTGAAGAAGATAATTCTCGAATGCAAGACAGGTAATGGAAAGGTTATT
GACTTTAAGACTCCTGATTAGCTCATTAAAGAAATAGATTTAACTCTTCCTTTAAAAGGA
TAGTCTGATGAAGAGATTATTAACTTCATTAAATTAGTTGACAAATATAGCGTTAAGACT
TCACACTCTCACTTTTTCAATAACCTCTTCGGTGGTTCAAATGAATATTCTTTAGCAGGA
GACTATTTCACATCTACAATTAATGGCTCTATGTATACTTATGAAATGGCCCCAGTTTTT
AACTTTATGGAAAACGCCATTTAGTAATTATTTGCAGAAAGATACTTAAAGTGGAGTACA
ATTGATGGAGTTTTCTGCCCAGGCGGTTCCTAATCTAATTTTTATGGTATCTTAGCAGCT
AGATAACACAAATATCCTGAATTTAAGAGAAAAGGTCTTCGTGCTCTTCCTGATTTGAAA
CTTTTCACATCTGAATTAGCTCACTATAGCATCGAAAAAGGAGCAATTATGCTTGGTTTT
GGTCTTGATTCTGTTGTCAAAATAGCTTGTGATGAAGAAGGAAGAATGATTCCTGAGGAA
TTCGAAAAGGAAATCTAAAAATGCATTTAAGAAGGTTCAGTAAGATAGACAATTATTTAT
TTTGCTTGAAGAAAATGAATTAAATAAATAAAAACCGAAGATAAATAAATAAACATATAA
AACAAAACTTATTTGAATCTGCTAAAATATTTTATAATTTCATTTTATTTTTAAAGATAT
TTTTTTAGTTCATAAAGAAAAAGCAGTATCCAAATGTAAAAATTTTATGATAAAAGATAT
TTTTTGATAGCTTTTATCAAAATTATTAACTAAAATACGTAATATTCATCAATAATATTT
ATTCTTTTATTAATCTAATTTAGGTTCCTTTAATGGTTAATTTGACCTGTGGTACAACAG
TCTTTGGTGTAGTTGATCCTATCAACAAATGCACTGAAATAGCACAAAAATATAACATGT
GGGTTCACATTGATGGCTGTTGGGGTGGTCACTTGATCTTTTTAGAAGAATTTAGAAATA
AATATAGCCTCATCAGCTAAGCTGATAGTTTCGCTTGGGATGCTCATAAATTATTTAATG
TTCCTTAATAATGTACAGCCTTTTTCACTAGACATGTTGGCTTGCTTCATGAAGCTAATG
CTTTAGGTAGCGACTATCTTTTCATGAAGGACAAAAAACTCTATGATGCAACTAAGTAAT
AAAATAAATTAAAAAATTAATATTTCATCTATTAATCAATACTTTCTTTAATAAAGATAT
GATTCAGGAGATAAGACTTACTAATGTGCAAGACATATAGATGTATTCAAATTTTGGATC
TACTGGAAACATTTTGGTACATTAGGTTTAGAATAAATTGTTGCTGATTCTTTAGAAACC
ACTAAATATTTTGCCTAGTTGGTTAAAGATCACCCTAACTGTGAATTAATCAATGAGCCT
GAATATGTTAGTGTCAGCTTTTTCTATTATCCTGACTCATTCTTAAAAAGAAAAGAATTA
GGAGAAGACAAAACAGAAAAATTCTGGGAAGACATGCATAATATTCCTCCTATCATCAAA
GCTAAAATGGTTGAGCAAGGTACAATGATGGTTGCCTATTAAAAACAAAACCAAAAATCA
ATTCAAAGAAAGAACTTCTTCAGATTTATCTTTACAGCTGATAAAGGAAAAGAAGAAGCA
TAATTTGCTCTTAATGAAATACACAGATTGGGTAAAGATTTATGATAATAATATTTACTG
TTGTATTTGTTTAACTGTAAAGTAAATAAATAAATTTAAATTTTAAATCTAAAACATT