Identifiers and Description

Gene Model Identifier

TTHERM_00283330

Standard Name

CET1

Aliases

PreTt04872 | 25.m00336 | p138 | 3694.m00119 | Spt16

Description

CET1 metallopeptidase family M24 containing protein; Protein associated with macronulear microtubules; sequence similarity to human transcription elongation factor FACT 140 kDa subunit- yeast Spt16/Cdc68- and Xenopus DUF140

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02016 ) LD-carboxypeptidase
  • ( PF00557 ) peptidase, M24 family
  • ( PF08512 ) Histone chaperone Rttp106-like
  • ( PF08644 ) FACT complex subunit (SPT16/CDC68)
  • ( TIGR02993 ) ectoine utilization protein EutD
  • ( PF01402 ) Ribbon-helix-helix protein, copG family
  • ( PF07334 ) Interferon-induced 35 kDa protein (IFP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00283330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08971.19.997093137033517e-262metallopeptidase family M24 co
ntaining protein (1010 aa)
WormBaseWBGene000188495.001363273675253e-167FACT complex subunit spt-16
status:Confirmed UniProt:Q9N
5R9 protein_id:CCD66831.1
DictyBaseDDB_G02826774.998437866964194e-166spt16 on chromosome: 3 positio
n 6105920 to 6109250
OxytrichaContig22561.0.g346.999646166012048e-157FACT complex subunit (SPT16/CD
C68)
SGDYGL207W1.0002534232488231e-144SPT16 Subunit of the heterodim
eric FACT complex (Spt16p-Pob3
p), which associates with chro
matin via interaction with Nhp
6Ap and Nhp6Bp, and reorganize
s nucleosomes to facilitate ac
cess to DNA by RNA and DNA pol
ymerases
Stentor CoeruleusSteCoe_186823.257488532207521e-70

General Information

Paragraph NoGene NameParagraph Text
128CET1The FACT-complex is a critical transcription regulator and an H2A/H2B chaperone. Affinity purification followed by mass spectrometry (AP-MS) of endogenously tagged T. thermophila histones H2A/H2B identified Cet1 and Pob3 subunits of the FACT complex as high-confidence interacting partners. Indirect immunofluorescence studies using endogenously tagged Cet1 indicated that it localized to both the MAC and MIC during vegetative growth. AP-MS analysis using Tetrahymena Cet1 as a bait protein revealed Pob3 and subunits of RNA polymerase as high-confidence co-purifying proteins (Ashraf et al. 2019).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):
  3. Ref:15013445: Fujiu K, Numata O (2004) Identification and molecular cloning of Tetrahymena 138-kDa protein, a transcription elongation factor homologue that interacts with microtubules in vitro. Biochemical and biophysical research communications 315(1):196-203

Sequences

>TTHERM_00283330(coding)
ATGAGCAAAGTTAAAGCTGATATCTTTTATCAACACCATAAGCAGCTATTGAGTGTTTGG
AATAAGCAACCTCAATACGCCAATATCGATGCTTTTATTATTAAAAATGGTAAAGATCAA
GGTGGAAATAAAATCAAAACTTCTGCCATTTCTATGTGGTATTTTGGTTTCGACTTCATT
GACACTATCCTTTTGATCACTAAAAAGACTTTTGCCATTATTGGTGGTAACAAGAAAATA
AACATGTTAAAATCTGTCTAGGAACACGCAGAAGCAAAAGAATACAATTTAGTTTTCATC
GAAAAAGACTAAGCAAACAATTCCAATCAACTTTAATAATTATTTGAAATTCTTGACAAA
GATTTGAACAAATCTAGCTTCAATATTGGAACTCTAGCTAAAGAATAGCAAGTTGGCCCT
TTTATGACTGAGTATGACTCATTTATTAAAGACAAAAATTAATATAAATTTGCTGATTGC
AGTGTATTTGTATAAGATTGTCTCTCTGTAAAAGATCAAAATGAAATATCTTACATTGGA
AAAGCTGCTAAAGTTAGTGTCTATTTAGAGTCTAAATTGATAAAAGAAATTGAAACAATC
ATTGAAGATGAAGGTAAAAAGACTCACAGTCAAATTGCTACTATGATTGAAGGATTGATT
GAAAATGAAAAAGAACTTAAAAAGATCTCAGAAGAAATTGGAGGTGAGAGTGACAATCTT
GATTTGGCTTATGTCCCAATTGTCTAATCTGGCGGCAAATATGATTTAAAACCAAATGCT
TAATCTAATGAAGATATTCTTTCTTATGACACAATTATTGTTTCAGTAGGTACTAAATAT
ATGGAATATCATGCTAATATTGTTCGTACCCTTTTCATTGACCCAACAAACGACTAAAAG
AAGATTTATTAGAGAGTTTATGAGCTCTAAAACTAGATCGCTGTCTAACTTAAGCCTGGT
ATTAAGCTCAAAACTGTTTATGAAAATGCAGTTAATTTCATTAATGAGAAAGTACCTCAA
TTGAAGGATAAGATCCCAGCTAATTTTGGATTTGGTATTGGTTTAGAATTTAGAGAATCT
AACTTGTACATTAATGCTAAAAACGAAAAAGAAGTTGAAGAAGGTATGGTCTTCAATGTT
GTTGTTGGTTTTGACAACTTGCAAAGTGAAAAGGAGAAAGCTTATGCCATACAAATTTCT
GACACTGTTGCAATTAGAAAGTAAAACACACCCAATGCTGTCATGACATTCAAAGTTTCT
AAGAAATATGAAGACATTTCTTACAGCATTTAAGATGAGGGTCAAGATGAAGAATAAGAA
GAGGAAGAAGATGATTTAGAAAAGGAAAACATTATTTAAGATGGACGCAGAACAAGAAAT
GCCTATCACAAAAATACAACTATTGTTTCAGAAAAAGAAAGACAAAAACACTAACTTGAA
TTGAGAGAAGTCAAATTAAAAGAATTACAAGAAAGATATAATAACAATGGATTCTTATCA
AATAAGATCAATTCCAGAGCTCTTGAGTTAGATAAGGTCTAGTGTTATGGTGGACCTCAA
GATATTCCCAAAGAATATAAGAAAAATTAAATTCATATTGATGCTGCTCATAATGCAATC
TTACTTCCTGTAAATGGTGAACTAGTTCCCTTCCACATTTCCTTAATTAAAAACTACTCT
AAAAACGACGAAGGAAAGACTCACACATTACGTCTTAACTTCCACAATCCTGGTAGTGGC
AGCAATTTAGCCAATATTACTTTCCCTAAGATTGATGGCTAAATTGTCTTTATTAAAGAA
CTCACTTTCCGTTCAAAGAACGCTAAAAATATGTTGGAAACAATTAAGAAAATCAAAGAC
TTGCAAGCTAAAGTTAAACAAACTGATCAAGAAGCTAAAAATAAAGACGAATTAGTAGAG
CAAGACAAATTACAATTACGTAACACAAAGAGACCTGCTTTAAGAAATTTAAAAGTACGT
CCTGCTATTTCTAAATAAAAAGTAAATGGTATGTTGGAATTGCACTTAAATGGTTTCAGA
TATATGACAACTAAAAATGAAAAAGTTGATGTCATCTTTAAAAATATAAAACATGCCATC
TTCTAACCTTGCGATAACGAAATGATTGTTGCCATACATTTCAATCTCAAGAATCCTATT
ATGATAGGCAAAAAGAAAGTTTGGGATGTACAATTTTATACAGAAGCTGGTCTTCCCCCA
GAGGATTTAAATAACAGAAGAAGAGGTCATGACTACGATGAAATAGAAGAAGAATAAATG
GAAAAAGCTCGTAGAAAGAAATTAAATAAGGACTTCGAAGCCTTCTACAAAGAAGTTGAA
AACTAGCTTGGAGATAAAATTAAGTTTGAAGTTCCATATGCCAATCTCGGTTTCTACGGT
TCACCAAGTAGATCTACTTGCCTCCTTTAACCTACATAAAATACCCTTATGAACATCATT
GAATTCCCCTTCTTTATCATGTCCTTAGAAGAAGTAGAATTAGCATGCTTCGAAAGAATG
ATCGGAAGACTTAAAAACTTTGATCTTGTCTTTATTTTCAAGGATTATGAAAAACAAGTT
ACAAGAATTGCCTCTATTCCTATTGATAAGGCAGAAATAGTTAAAAATTGGTTAAACAGC
TAAAATATATTGTATTTTGAATCTACAAAGAGTTTCTCTTGGGCTAATATCTTAAAGACC
ATTCGCTAAGATATTGGTGGCTTCATTGAAGATGGAGGTTGGAATATTATTTTGGGTGAA
GATGAAGGAGAAGATGAAGATCCTGATGAGGGTGATGAAGATTTCTCAGTAGAACAAGAC
GAAGAGGAAGAAGAAAGTGAAGAGATTTCTGAAAGTGATGAGGATTTCGATGATGAAGAA
AGTGCGAGTGATTTTGAAGGAGATGAAGATCTCAGTGAAGAAGGCTAAAGCTGGAGCGAT
CTTGAAGAAAACGCTAGAAAGGAAGAAGAGAGAAGAAAGTAACAACAAGTAAAACCAACA
AAGCCTGTTCCTTAAAAAAGAAGATGA


>TTHERM_00283330(protein)
MSKVKADIFYQHHKQLLSVWNKQPQYANIDAFIIKNGKDQGGNKIKTSAISMWYFGFDFI
DTILLITKKTFAIIGGNKKINMLKSVQEHAEAKEYNLVFIEKDQANNSNQLQQLFEILDK
DLNKSSFNIGTLAKEQQVGPFMTEYDSFIKDKNQYKFADCSVFVQDCLSVKDQNEISYIG
KAAKVSVYLESKLIKEIETIIEDEGKKTHSQIATMIEGLIENEKELKKISEEIGGESDNL
DLAYVPIVQSGGKYDLKPNAQSNEDILSYDTIIVSVGTKYMEYHANIVRTLFIDPTNDQK
KIYQRVYELQNQIAVQLKPGIKLKTVYENAVNFINEKVPQLKDKIPANFGFGIGLEFRES
NLYINAKNEKEVEEGMVFNVVVGFDNLQSEKEKAYAIQISDTVAIRKQNTPNAVMTFKVS
KKYEDISYSIQDEGQDEEQEEEEDDLEKENIIQDGRRTRNAYHKNTTIVSEKERQKHQLE
LREVKLKELQERYNNNGFLSNKINSRALELDKVQCYGGPQDIPKEYKKNQIHIDAAHNAI
LLPVNGELVPFHISLIKNYSKNDEGKTHTLRLNFHNPGSGSNLANITFPKIDGQIVFIKE
LTFRSKNAKNMLETIKKIKDLQAKVKQTDQEAKNKDELVEQDKLQLRNTKRPALRNLKVR
PAISKQKVNGMLELHLNGFRYMTTKNEKVDVIFKNIKHAIFQPCDNEMIVAIHFNLKNPI
MIGKKKVWDVQFYTEAGLPPEDLNNRRRGHDYDEIEEEQMEKARRKKLNKDFEAFYKEVE
NQLGDKIKFEVPYANLGFYGSPSRSTCLLQPTQNTLMNIIEFPFFIMSLEEVELACFERM
IGRLKNFDLVFIFKDYEKQVTRIASIPIDKAEIVKNWLNSQNILYFESTKSFSWANILKT
IRQDIGGFIEDGGWNIILGEDEGEDEDPDEGDEDFSVEQDEEEEESEEISESDEDFDDEE
SASDFEGDEDLSEEGQSWSDLEENARKEEERRKQQQVKPTKPVPQKRR


>TTHERM_00283330(gene)
ATGAGCAAAGTTAAAGCTGATATCTTTTATCAACACCATAAGCAGCTATTGAGTGTTTGG
AATAAGGTAATTAGATATACTTTGTTAGCATTTTTTTATATTTTTAATTGCTGGTTTCCA
TTCACTAACTTTTCATTTTATATTCTAGCAACCTCAATACGCCAATATCGATGCTTTTAT
TATTAAAAATGGTAAAGATCAAGGTGGAAATAAAATCAAAACTTCTGCCATTTCTATGTG
GTATTTTGGTTTCGACTTCATTGACACTATCCTTTTGATCACTAAAAAGACTTTTGCCAT
TATTGGTGGTAACAAGAAAAGTAATTTTGCATTTCTAGAATAATTTCATGCATTAAATTT
GTGCTTGATAATGCCAACAATTAGCTAAATTATTTCAATTATAAAAAAGTAAACATGTTA
AAATCTGTCTAGGAACACGCAGAAGCAAAAGAATACAATTTAGTTTTCATCGAAAAAGAC
TAAGCAAACAATTCCAATCAACTTTAATAATTATTTGAAATTCTTGACAAAGATTTGAAC
AAATCTAGCTTCAATGTAAATTCAAATATTATATTTAAATTGAATTTAGACTCATTTTGT
GTCTCAACTGTAATTATGCAGACACAGGCAGGGATGAATCTGAAAGAATTTTAAGCAATT
AAAATAAATTTTATCAAATTTTAACAATTTATTAAAGATTGGAACTCTAGCTAAAGAATA
GCAAGTTGGCCCTTTTATGACTGAGTATGACTCATTTATTAAAGACAAAAATTAATATAA
ATTTGCTGATTGCAGTGTATTTGTATAAGATTGTCTCTCTGTAAAAGATCAAAATGAAAT
AGTAATTTATTTGATATTTAAATTTAGAATACAATTTTTTAAGATAATTATCTGAAAGAG
TTTTAGAAGCTTTTCTTTTGACATAATTTGTTTATTTTGATTTCATTATTTTATTAAACT
TTCTATCCATAACTAAAACAGTCTTACATTGGAAAAGCTGCTAAAGTTAGTGTCTATTTA
GAGTCTAAATTGATAAAAGAAATTGAAACAATCATTGAAGATGAAGGTAAAAAGACTCAC
AGTCAAATTGCTACTATGATTGAAGGATTGATTGAAAATGAAAAAGAACTTAAAAAGATC
TCAGAAGTAAAAAATATTTAACATTATTTAAGTAAAAGCAATATAAAGCAAAGTTCATTC
AAAAAAGCATTGATTATCAAAATTTTCATTTAAGTGCATGATAATTTAAATAAAATAAAA
CGAAGTTTCATTAGGAACTTATAGCAAACAGCAGCAATATAATCATTTGAAATTATGAAT
AGCATTAAGTTATTAAATTTAAAATTTAAATTTATAGGAAATTGGAGGTGAGAGTGACAA
TCTTGATTTGGCTTATGTCCCAATTGTCTAATCTGGCGGCAAATATGATTTAAAGTAAAT
AACTACTTATCCATTTAAAAAATTAAATAAAATACTCATTAAAATATCAATAGACCAAAT
GCTTAATCTAATGAAGATATTCTTTCTTATGACACAATTATTGTTTCAGTAGGTACTAAA
TATATGGAATATCATGCTAATATTGTTCGTACCCTTTTCATTGACCCAACAAACGACTAA
AAGAAGATTTATTAGAGAGTTTATGAGCTCTAAAACTAGATCGCTGTCTAACTTAAGCCT
GGTATTAAGCTCAAAACTGTTTATGAAAATGCAGTTAATTTCATTAATGAGAAAGTACCT
CAATTGAAGGATAAGATCCCAGCTAATTTTGGATTTGGTGTAATAATTTATTTACAATTT
GAGTGCTTTAGCAAGTAATTTAAATTTTTATATTGTATGATAATAGATTGGTTTAGAATT
TAGAGAATCTAACTTGTACATTAATGCTAAAAACGAAAAAGAAGTTGAAGAAGGTATGGT
CTTCAATGTTGTTGTTGGTTTTGACAACTTGCAAAGTGAAAAGGAGAAAGCTTATGCCAT
ACAAATTTCTGACACTGTTGCAATTAGAAAGTAAAACACACCCAATGCTGTCATGACATT
CAAAGTTTCTAAGAAATATGAAGACATTTCTTACAGCATTTAAGATGAGGGTCAAGATGA
AGAATAAGAAGAGGAAGAAGATGATTTAGAAAAGGAAAACATTATTTAAGATGGACGCAG
AACAAGAAATGCCTATCACAAAAATACAACTATTGTTTCAGAAAAAGAAAGACAAAAACA
CTAACTTGAATTGAGAGAAGTCAAATTAAAAGAATTACAAGAAAGATATAATAACAATGG
ATTCTTATCAAATAAGATCAATTCCAGAGCTCTTGAGTTAGATAAGGTCTAGTGTTATGG
TGGACCTCAAGATATTCCCAAAGAATATAAGAAAAATTAAATTCATATTGATGCTGCTCA
TAATGCAATCTTACTTCCTGTAAATGGTGAACTAGTTCCCTTCCACATTTCCTTAATTAA
AAACTACTCTAAAAACGACGAAGGAAAGACTCACACATTACGTCTTAACTTCCACAATGT
AAATAAATATATTAATTTTTACTCATTTTCAAATAATTTATTAATATTATTTACTTTTAA
AAAATAATTAGCCTGGTAGTGGCAGCAATTTAGCCAATATTACTTTCCCTAAGATTGATG
GCTAAATTGTCTTTATTAAAGAACTCACTTTCCGTTCAAAGAACGCTAAAAATATGTTGG
AAACAATTAAGAAAATCAAAGACTTGCAAGCTAAAGTTAAACAAACTGATCAAGAAGCTA
AAAATAAAGACGAATTAGTAGAGCAAGACAAATTACAATTACGTAACACAAAGAGACCTG
CTTTAAGAAATTTAAAAGTACGTCCTGCTATTTCTAAATAAAAAGTAAATGGTATGTTGG
AATTGCACTTAAATGGTTTCAGATATATGACAACTAAAAATGAAAAAGTTGATGTCATCT
TTAAAAATATAAAACATGCCATCTTCTAACCTTGCGATAACGAAATGATTGTTGCCATAC
ATTTCAATCTCAAGAATCCTATTATGATAGGCAAAAAGAAAGTTTGGGATGTACAATTTT
ATACAGAAGCTGGTCTTCCCCCAGAGGATTTAAGTAAGAGAATTTAACATTTTTTTAATG
TTTATTAATAAAATTTAAATTAAATTAATAAAGATAACAGAAGAAGAGGTCATGACTACG
ATGAAATAGAAGAAGAATAAATGGAAAAAGCTCGTAGAAAGAAATTAAATAAGGACTTCG
AAGCCTTCTACAAAGAAGTTGAAAACTAGCTTGGAGATAAAATTAAGTTTGAAGTTCCAT
ATGCCAATCTCGGTTTCTACGGTTCACCAAGTAGATCTACTTGCCTCCTTTAACCTACAT
AAAATACCCTTATGAACATCATTGAATTCCCCTTCTTTATCATGTCCTTAGAAGAAGTAG
AATTAGCATGCTTCGAAAGAATGATCGTAAATAAATTAAAAAAAATTCTATTTAATCAAT
CAAAAAATTTATATAAACTGAATATTTATTTATTTACTTACTTACTTACTTACTTACTAA
CACATTTTTATTTAACTAATTTAGGGAAGACTTAAAAACTTTGATCTTGTCTTTATTTTC
AAGGATTATGAAAAACAAGTTACAAGAATTGCCTCTATTCCTATTGATAAGGCAGAAATA
GTTAAAAATTGGTTAAACAGCTAAAATATATTGTATTTTGAATCTACAAAGAGTTTCTCT
TGGGCTAATATCTTAAAGACCATTCGCTAAGATATTGGTGGCTTCATTGAAGATGGAGGT
TGGAATATTATTTTGGGTGAAGATGAAGGAGAAGATGAAGATCCTGATGAGGGTGATGAA
GATTTCTCAGTAGAACAAGACGAAGAGGAAGAAGAAAGTGAAGAGATTTCTGAAAGTGAT
GAGGATTTCGATGATGAAGAAAGTGCGAGTGATTTTGAAGGAGATGAAGATCTCAGTGAA
GAAGGCTAAAGCTGGAGCGATCTTGAAGAAAACGCTAGAAGTAATTAATTAATTAATTTT
TATCAATAATTGATAAATTTAAGAATAATCTAATTTATTTTTAATAATACAGAGGAAGAA
GAGAGAAGAAAGTAACAACAAGTAAAACCAACAAAGCCTGTTCCTTAAAAAAGAAGATGA