Identifiers and Description

Gene Model Identifier

TTHERM_00279820

Standard Name

None

Aliases

PreTt04822 | 25.m00286 | 3694.m00071

Description

glutathione peroxidase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00279820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08929.19.997093137033517e-262hypothetical protein (1340 aa)
OxytrichaContig18732.0.g320.00000000000040012475857291343Zinc knuckle
SGDYNL255C0.0000009995106777214876GIS2 Translational activator f
or mRNAs with internal ribosom
e entry sites; associates with
polysomes and binds to a spec
ific subset of mRNAs; ortholog
of human ZNF9/CNBP, a gene in
volved in myotonic dystrophy t
ype 2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00279820(coding)
ATGGATTCTACATTAACTTAAGATGTTTAGTCTTCTAATCCATAGGCGATGAACAAGTTT
GAAAATACAAAGAGAAAGAAACCTTGGGAAGTATTTAAGAAGCAAACAATAGAAGAAGAA
AAACCAGAGAGTGTTTAGTAGTTTGATTCATTCCGTGATAAGTGTGCTCACAACATGTAA
AGTGGAGCTGGCTTTACAGCATTCTTAAATAATGCAATGTAGCAAGATAATAACTTCTAG
ATTAAGCTGAATAAGAACTAATATTATTAAAATTTAAATAAGAACAAAAAGCTATTTGGC
TTAAATAACTATTAAAGTACCAAGTCTAATAAATAAGGAGGTGGCAACCAAAGCAGAATA
TAAGAAGATAATAATTAGCCTAGATTTAATGCAGTAGTCAAGAATAATTTTGAAAAATAA
AGCAATTACCACACAAAAAAGAACGATGAAACAAAGGAAAACACAAACAACTAAAATTTT
AACAAATAAAACACCTTTCATTTTAATCCATTCAATAAACATGAATAACAGCATGCAAAT
TAAGAATTAAGCAAGGACGTTTAGCATTTGAATAAAGATGAAATTTCTAAGGCCAAATAC
CTAGAACGTAAATAGAAGAAGGTAAGTGATTTAATAGAATAATAAGCATCTCGTGCATTA
AGAAGAGAAGAAGGAGAAAACATACCTTCAGATGAAGATCCTTTAATGAATTATTTATCT
GATTCTTCATCAAATGAGTCAGATGGTGAAGGAAATAAGAAAAAAACAAATCTTTCCTCT
TCATAAAAAAAGAAAAGATCAGGTTTAACAAGAAGGAGATAAAAAATTTGCGGCTCATGG
GTAAGAGTTTGTGATACTTAAAAGCTAGATAAACCTCCAAGCTATAAAGATTATTTAGGA
GCTTTAACTAATGCTAAAGGAAAAAGACCTTTAGAAGAACTGAATAATAAAGACGATGAT
CTATATGAAGTCAACAAAGAATTAGCATAAGATGCAGAGGATGGTGAGTTAAAAGCAGTT
GCTGACCTTGAGGATGGAGAAATAAAAATGTAGGAAGAAGATTTCTTTTTAAAGAATAAT
GCAGATATAAAATTTTAGCAAGAATTAGAGTTTCCTTTCCCAACAAGAAAAATTCAGCAA
AAGCCTCATAAAAGCAAAAATTTTATGAATATTAGTCCCACTAAAATTTTGAACACACTT
AGAAAGACAAGCCTTTTAGATGAAGAAGATGAAGCAACTTATAAAAAAAAGCAAAAAATT
CCTACAAAAGAGGAACTTCTAGAATAGGAAAATAAGTTATTAGAAAATCAAAGCCAACAA
ATTTAAGATTCTACAAATCCACTTTAACTTCTTAAGAAAATGGATTAACTTGGAAACGAA
GCATTCAAAAACAGAACAGGCAACAACTTTTAAATGCAATAAACTCTTGCTGCATAGCAA
GATCTTTTCCTTCATTCATATTTCAATAAATCCAAACATAAAGGGGAAAATTTAAATCAA
GAAGGCAACGCTGCAGCAGCCAAAAAAGAGAAAAGATTTGACCCTAAAAATTATTACATA
GATATTGAAAAAAATATGATTGATAATAATGTGTAGATGACTGAAGGACTGCTTGCTCTT
GCTAAGATTTAGAAAGAATAATATGTCTCTGGGGTTAAAAAGAAAACTAAATAGAATAAA
GATATTCTTTCTGGTTCAAATTTTAGCAGTGGAAGTGGAAGCAAAATAAATAAAATATTG
TAGCAAGATAGCACAGAGAAGGAATTAAGAGATGCTTCCTAGAGATTAACAAAGTAAGCT
GGAATGAAAGACTTGTAGTCCAAGTTAAATTTTGATTAAAATAACTCACACCCTCTTTTA
CTTTAAAAAGAGAAGCAGAATGAATAATTTAACAAAGCACTAAATAAATACGAAGAAGAA
GTAAACAAAAAAGAAGAGCTTATTAAATAGATTTAGTAGTAAAAAAAGAAGGAGGAGAAG
ATGAATCAAAATACAGATTAAGCAACCGAAGAAGCTAAGCAATAAGGGAAATAAAGTGAT
GATGCTACAGAAGCAAATGCAGAAGCAAAAGAAGGAGAAGAAATGGATATTGATGATGAA
GATTTGAATGAATTTGAAAAGTTTAATGAAGAATACTTGAAACAGTAAGAAAAAATGTTA
GAGGAGATATAGAAAAAAAATAAAGAAAAGGTGAATGAAATTAAAAATTCCAAGTCTTTA
GATCTTGGATTAGGCCTAGAATTTGGATTAGATTACTCGTAAAAAGAAGAGCAATTAAAT
CCTCTTGAAAAAATGATCCAAGAAGAATTAGAAAGAAACCGTTAAGACAAACAACAATAA
AATTTCCGCCTTATGGAATTATAAAAGCTCCAAGGAAATCAACATATTCAGCACGCACAT
TTATTAGCAAAATCTACTGTAAACGAAACCAATAATTCCTACAAGAATTTAAATGATAAT
CCTTATGCTAAAATAACATAATAAAATTTATATGCTATGTCCAATAACCCAACTGATAAT
TAAAACAACAAAAGAAGAAATAAATTTTCAGAAATCCCCACTCTTCCTGCTTAATTTGCT
AATGTTGAAACATTTGCCTAAATGGAAAGACTTAAGCAATTAACCCAAGCACAAAAATCA
TAAAACTAAACCTAAATCTAACCACCTCAATAAACCAAAAAAGAAGCATATCCAAATGAA
ATGACCTCTCTTTCTCAATTACAACAATAGCTATTCACAAAGAACCAGTAATTAATTAAG
TAAGAATTTCCAGACAGATCAAAAAGCAAAATGGAACTAGAGCATTAAGACAGCAAGTCT
TCTAAATTCTCATCATAAATTCCTACTTTTAATTTGCCATAAATTAATAATAAGAATGAA
GATAATCGCATTTAATAGGAAGAACAAAAACCAATTAGAAAGATCAGCTTTGATAAAAGT
GTTAACATTCCAGAAAATATCAAATCCATGGAAATGCAATTAAAACCTGAAAAATATGAA
AAAATGGTTCTTGAATACATAAACATGTACAAAAAGTAGAAAGAGGAAATTCAAATTGAT
AAAATAAAGGATCCCAGACTGCGTGCCCGTGCCACCAATAACTTTGAAGAAAAAATATAA
TAATTTGCCTCATAATTAGTCAAAGACTATACTGAAAAAATAAATAATTACATTCCTATG
GCGAATGAAGATAATAGCTTACCGCTTCCTAGTATACAAGATGATTCTGGAAACAAGAGA
AAGACAAGTTTATTAAGCTTTTCAGTAGAGACAAGCACCATGCCAGCATAAGGTAAACAA
GAAGTATCTGATGATAAGGTGGTATACAATTATAAAGTACTAAAGAGTGAAAGAAATTTT
ATTACACAAGAGAAAAATTTAATTGAAAAGCATAGTGCTTTATCTTTCCTTTAAGGATCT
TCTTAAGGTCCTGATTAATTCCAATTACTTCGCATGCCTTAGAAAGAAGAATCAACTGAA
AATTAGAATGATGAATTTAAGGATCTATTTAAGAATGAAAAAGAATTAAGATACTTTAAA
GAAAATAAAGCAATAACTTGCTTTAAGTGCCATAGAAACGGTCATACAGCATAATTATGT
ACAAATCAGTCTGAAGAAAGAAGTAAATGTGTCTTCTGTCTTGGCGATCACTCAAAAGAT
TACTGTACCAACTATGTTTGCTTCAAGTGCTATCTAGTTGGTCACCGTATTAAAGATTGT
GCTTTTGAGCAATCTATGGATTAATCTCGCTGCAGAATCTGCAGAAAGAAAGGACACACT
TTAAAACAATGTGGATCTCTTAATTTAGACATAGTTTAGAAAAGCTATGATTTCTACTCC
ATGAACGAAACAATTTGCTTAAATTGCAGAGAGCCTGGGCATATTAACTGTTTTAATCCT
TAATTATACATTAATTATGATGGACTATATAAGCTAGATCAAGAAACCCTAGATAAATTA
TTTTGA


>TTHERM_00279820(protein)
MDSTLTQDVQSSNPQAMNKFENTKRKKPWEVFKKQTIEEEKPESVQQFDSFRDKCAHNMQ
SGAGFTAFLNNAMQQDNNFQIKLNKNQYYQNLNKNKKLFGLNNYQSTKSNKQGGGNQSRI
QEDNNQPRFNAVVKNNFEKQSNYHTKKNDETKENTNNQNFNKQNTFHFNPFNKHEQQHAN
QELSKDVQHLNKDEISKAKYLERKQKKVSDLIEQQASRALRREEGENIPSDEDPLMNYLS
DSSSNESDGEGNKKKTNLSSSQKKKRSGLTRRRQKICGSWVRVCDTQKLDKPPSYKDYLG
ALTNAKGKRPLEELNNKDDDLYEVNKELAQDAEDGELKAVADLEDGEIKMQEEDFFLKNN
ADIKFQQELEFPFPTRKIQQKPHKSKNFMNISPTKILNTLRKTSLLDEEDEATYKKKQKI
PTKEELLEQENKLLENQSQQIQDSTNPLQLLKKMDQLGNEAFKNRTGNNFQMQQTLAAQQ
DLFLHSYFNKSKHKGENLNQEGNAAAAKKEKRFDPKNYYIDIEKNMIDNNVQMTEGLLAL
AKIQKEQYVSGVKKKTKQNKDILSGSNFSSGSGSKINKILQQDSTEKELRDASQRLTKQA
GMKDLQSKLNFDQNNSHPLLLQKEKQNEQFNKALNKYEEEVNKKEELIKQIQQQKKKEEK
MNQNTDQATEEAKQQGKQSDDATEANAEAKEGEEMDIDDEDLNEFEKFNEEYLKQQEKML
EEIQKKNKEKVNEIKNSKSLDLGLGLEFGLDYSQKEEQLNPLEKMIQEELERNRQDKQQQ
NFRLMELQKLQGNQHIQHAHLLAKSTVNETNNSYKNLNDNPYAKITQQNLYAMSNNPTDN
QNNKRRNKFSEIPTLPAQFANVETFAQMERLKQLTQAQKSQNQTQIQPPQQTKKEAYPNE
MTSLSQLQQQLFTKNQQLIKQEFPDRSKSKMELEHQDSKSSKFSSQIPTFNLPQINNKNE
DNRIQQEEQKPIRKISFDKSVNIPENIKSMEMQLKPEKYEKMVLEYINMYKKQKEEIQID
KIKDPRLRARATNNFEEKIQQFASQLVKDYTEKINNYIPMANEDNSLPLPSIQDDSGNKR
KTSLLSFSVETSTMPAQGKQEVSDDKVVYNYKVLKSERNFITQEKNLIEKHSALSFLQGS
SQGPDQFQLLRMPQKEESTENQNDEFKDLFKNEKELRYFKENKAITCFKCHRNGHTAQLC
TNQSEERSKCVFCLGDHSKDYCTNYVCFKCYLVGHRIKDCAFEQSMDQSRCRICRKKGHT
LKQCGSLNLDIVQKSYDFYSMNETICLNCREPGHINCFNPQLYINYDGLYKLDQETLDKL
F


>TTHERM_00279820(gene)
ATGGATTCTACATTAACTTAAGATGTTTAGTCTTCTAATCCATAGGCGATGAACAAGTTT
GAAAATACAAAGAGAAAGAAACCTTGGGAAGTATTTAAGAAGCAAACAATAGAAGAAGAA
AAACCAGAGAGTGTTTAGTAGTTTGATTCATTCCGTGATAAGTGTGCTCACAACATGTAA
AGTGGAGCTGGCTTTACAGCATTCTTAAATAATGCAATGTAGCAAGATAATAACTTCTAG
ATTAAGCTGAATAAGAACTAATATTATTAAAATTTAAATAAGAACAAAAAGCTATTTGGC
TTAAATAACTATTAAAGTACCAAGTCTAATAAATAAGGAGGTGGCAACCAAAGCAGAATA
TAAGAAGATAATAATTAGCCTAGATTTAATGCAGTAGTCAAGAATAATTTTGAAAAATAA
AGCAATTACCACACAAAAAAGAACGATGAAACAAAGGAAAACACAAACAACTAAAATTTT
AACAAATAAAACACCTTTCATTTTAATCCATTCAATAAACATGAATAACAGCATGCAAAT
TAAGAATTAAGCAAGGACGTTTAGCATTTGAATAAAGATGAAATTTCTAAGGCCAAATAC
CTAGAACGTAAATAGAAGAAGGTAAGTGATTTAATAGAATAATAAGCATCTCGTGCATTA
AGAAGAGAAGAAGGAGAAAACATACCTTCAGATGAAGATCCTTTAATGAATTATTTATCT
GATTCTTCATCAAATGAGTCAGATGGTGAAGGAAATAAGAAAAAAACAAATCTTTCCTCT
TCATAAAAAAAGAAAAGATCAGGTTTAACAAGAAGGAGATAAAAAATTTGCGGCTCATGG
GTAAGAGTTTGTGATACTTAAAAGCTAGATAAACCTCCAAGCTATAAAGATTATTTAGGA
GCTTTAACTAATGCTAAAGGAAAAAGACCTTTAGAAGAACTGAATAATAAAGACGATGAT
CTATATGAAGTCAACAAAGAATTAGCATAAGATGCAGAGGATGGTGAGTTAAAAGCAGTT
GCTGACCTTGAGGATGGAGAAATAAAAATGTAGGAAGAAGATTTCTTTTTAAAGAATAAT
GCAGATATAAAATTTTAGCAAGAATTAGAGTTTCCTTTCCCAACAAGAAAAATTCAGCAA
AAGCCTCATAAAAGCAAAAATTTTATGAATATTAGTCCCACTAAAATTTTGAACACACTT
AGAAAGACAAGCCTTTTAGATGAAGAAGATGAAGCAACTTATAAAAAAAAGCAAAAAATT
CCTACAAAAGAGGAACTTCTAGAATAGGAAAATAAGTTATTAGAAAATCAAAGCCAACAA
ATTTAAGATTCTACAAATCCACTTTAACTTCTTAAGAAAATGGATTAACTTGGAAACGAA
GCATTCAAAAACAGAACAGGCAACAACTTTTAAATGCAATAAACTCTTGCTGCATAGCAA
GATCTTTTCCTTCATTCATATTTCAATAAATCCAAACATAAAGGGGAAAATTTAAATCAA
GAAGGCAACGCTGCAGCAGCCAAAAAAGAGAAAAGATTTGACCCTAAAAATTATTACATA
GATATTGAAAAAAATATGATTGATAATAATGTGTAGATGACTGAAGGACTGCTTGCTCTT
GCTAAGATTTAGAAAGAATAATATGTCTCTGGGGTTAAAAAGAAAACTAAATAGAATAAA
GATATTCTTTCTGGTTCAAATTTTAGCAGTGGAAGTGGAAGCAAAATAAATAAAATATTG
TAGCAAGATAGCACAGAGAAGGAATTAAGAGATGCTTCCTAGAGATTAACAAAGTAAGCT
GGAATGAAAGACTTGTAGTCCAAGTTAAATTTTGATTAAAATAACTCACACCCTCTTTTA
CTTTAAAAAGAGAAGCAGAATGAATAATTTAACAAAGCACTAAATAAATACGAAGAAGAA
GTAAACAAAAAAGAAGAGCTTATTAAATAGATTTAGTAGTAAAAAAAGAAGGAGGAGAAG
ATGAATCAAAATACAGATTAAGCAACCGAAGAAGCTAAGCAATAAGGGAAATAAAGTGAT
GATGCTACAGAAGCAAATGCAGAAGCAAAAGAAGGAGAAGAAATGGATATTGATGATGAA
GATTTGAATGAATTTGAAAAGTTTAATGAAGAATACTTGAAACAGTAAGAAAAAATGTTA
GAGGAGATATAGAAAAAAAATAAAGAAAAGGTGAATGAAATTAAAAATTCCAAGTCTTTA
GATCTTGGATTAGGCCTAGAATTTGGATTAGATTACTCGTAAAAAGAAGAGCAATTAAAT
CCTCTTGAAAAAATGATCCAAGAAGAATTAGAAAGAAACCGTTAAGACAAACAACAATAA
AATTTCCGCCTTATGGAATTATAAAAGCTCCAAGGAAATCAACATATTCAGCACGCACAT
TTATTAGCAAAATCTACTGTAAACGAAACCAATAATTCCTACAAGAATTTAAATGATAAT
CCTTATGCTAAAATAACATAATAAAATTTATATGCTATGTCCAATAACCCAACTGATAAT
TAAAACAACAAAAGAAGAAATAAATTTTCAGAAATCCCCACTCTTCCTGCTTAATTTGCT
AATGTTGAAACATTTGCCTAAATGGAAAGACTTAAGCAATTAACCCAAGCACAAAAATCA
TAAAACTAAACCTAAATCTAACCACCTCAATAAACCAAAAAAGAAGCATATCCAAATGAA
ATGACCTCTCTTTCTCAATTACAACAATAGCTATTCACAAAGAACCAGTAATTAATTAAG
TAAGAATTTCCAGACAGATCAAAAAGCAAAATGGAACTAGAGCATTAAGACAGCAAGTCT
TCTAAATTCTCATCATAAATTCCTACTTTTAATTTGCCATAAATTAATAATAAGGTAAAA
ATCAACAATTGACTTAAATTTATTAAAAACTTATTTTTAAATTTCAAAATTTTCCATAAA
AAAATTATTATGAAAAAAAATATTTGCAATTTAAATCATTGATAATTTTCAAATTAAGAA
GTTTAAATGAAAAGAAAAATGTAAAGACTTTTTTAAGGTTAAAATATTTTATTATTAAAA
AAGAATGAAGATAATCGCATTTAATAGGAAGAACAAAAACCAATTAGAAAGATCAGCTTT
GATAAAAGTGTTAACATTCCAGAAAATATCAAATCCATGGAAATGCAATTAAAACCTGAA
AAATATGAAAAAATGGTTCTTGAATACATAAACATGTACAAAAAGTAGAAAGAGGAAATT
CAAATTGATAAAATAAAGGATCCCAGACTGCGTGCCCGTGCCACCAATAACTTTGAAGAA
AAAATATAATAATTTGCCTCATAATTAGTCAAAGACTATACTGAAAAAATAAATAATTAC
ATTCCTATGGCGAATGAAGATAATAGCTTACCGCTTCCTAGTATACAAGATGATTCTGGA
AACAAGAGAAAGACAAGTTTATTAAGCTTTTCAGTAGAGACAAGCACCATGCCAGCATAA
GGTAAACAAGAAGTATCTGATGATAAGGTGGTATACAATTATAAAGTACTAAAGAGTGAA
AGAAATTTTATTACACAAGAGAAAAATTTAATTGAAAAGCATAGTGCTTTATCTTTCCTT
TAAGGATCTTCTTAAGGTCCTGATTAATTCCAATTACTTCGCATGCCTTAGAAAGAAGAA
TCAACTGAAAATTAGAATGATGAATTTAAGGATCTATTTAAGAATGAAAAAGAATTAAGA
TACTTTAAAGAAAATAAAGCAATAACTTGCTTTAAGTGCCATAGAAACGGTCATACAGCA
TAATTATGTACAAATCAGTCTGAAGAAAGAAGTAAATGTGTCTTCTGTCTTGGCGATCAC
TCAAAAGATTACTGTACCAACTATGTTTGCTTCAAGTGCTATCTAGTTGGTCACCGTATT
AAAGATTGTGCTTTTGAGCAATCTATGGATTAATCTCGCTGCAGAATCTGCAGAAAGAAA
GGACACACTTTAAAACAATGTGGATCTCTTAATTTAGACATAGTTTAGAAAAGCTATGAT
TTCTACTCCATGAACGAAACAATTTGCTTAAATTGCAGAGAGCCTGGGCATATTAACTGT
TTTAATCCTTAATTATACATTAATTATGATGGACTATATAAGCTAGATCAAGAAACCCTA
GATAAATTATTTTGA