Identifiers and Description

Gene Model Identifier

TTHERM_00267860

Standard Name

CDK13 (Cyclin Dependent Kinase 13)

Aliases

PreTt09821 | 24.m00252 | 3690.m00066

Description

Rck kinase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00357 ) Integrin alpha cytoplasmic region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00267860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06888.19.997093137033517e-262protein kinase domain-containi
ng protein (683 aa)
OxytrichaContig15886.0.g143.000551941601253e-121Protein kinase domain
DictyBaseDDB_G02680784.999984259728227e-105DDB_G0268078 on chromosome: 1
position 1417972 to 1419590
WormBaseWBGene000011211.0002646133906571e-103locus:dyf-5 status:Confirmed
UniProt:B3WFY8 protein_id
:CAQ76489.2
SGDYBR160W2.9997246065828143e-59CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
Stentor CoeruleusSteCoe_228207.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000268

Sequences

>TTHERM_00267860(coding)
ATGAATATATTCATTAAAATTATTAATTAAATAGAGAGCAAATAAAGAAAAAAAGTTAAT
AAGAAATCAATTATTAAATTAATTAATTTTCTAAATAAGTTTAAATAGTTAAATATTAAA
AAAGAAATATTCAAAATGGAAAAATATAATATAATTAGCGAGATTGGAAGAGGTGCTTTC
GGTATCGTTAAGAAAGCTTAAAATAAGGAAACGAAGGAAATTGTGGCTATTAAGTAAATG
TTGTAGGAGTATGAGACATGGGACGAGTGCATTAATTTAAGGGAATTGAAATCACTTAGG
AAATTGACACACGTGAATATCATAAAACTCAAAGAAGTGTTTCGCGTCAAGAAACAGCTT
TCGTTTGTTTTTGAATATGTTGAAAAGAATATATATAAACTATATGAAAATGCAAAGCAA
GATGGAGCAACATCCCTGCCAGAAAACACAATAAAAAGCATAGTTTATTAAATTGCCTCT
GCACTTTCATATATGCATAAACATGGTTTTTTCCACCGTGATTTGAAGCCAGAAAATCTC
CTGATCTCAAGCGATGGGATTGTAAAGTTGATTGACTTCGGATTAGCTCGTGAAGTGCGT
TCTCGTCCTCCATACACTGATTATGTTTCTACTAGATGGTATAGAGCACCCGAAATATTA
CTACGCTCTACTCATTATAATAGTCCAGTCGACATTTTCGCTTTAGGTTGCATCATGGCA
GAGTTATATTTAATGAAGCCGCTTTTCAACGGTTCTTCTGAAATAGATCAGATATAAAAA
ATAACTTCAGTTTTAGGCACTCCCCAAAAATAGGATTGGCCTGATGGGTTTATTTTAGCC
TCAACAAAGTATTATACTTTCCCTTAGTACCCAGCGATTCCTTTATCACAAGTTATTCCA
AATTGTCCTCCTGATGCACTTAATTTAATCTCAGAAATGCTTAAATGGGATCCATAAAAA
AGAATAACTGCTGCCAAGATACTTTAGCATCCATATTTTAGCAATGTAGAATTACCAGAA
GAATTAACAGCTGAAAGCAATAGCAATTAAATGATACAATCCTCTAATTAGCCAGCAACT
TTATTAGGGGGTGCCAGTTCAAACAATGCAGAGTCAGTTTGGAATCAGAGTGGCAACAAT
AATGCAAATCTAAACCAATTTTAAGGAAATGTAAATGCAAGTTAAAATGTTCCTGCAAAT
TCTCGTTTGGGTGGTCATTCTAATACAGCAAATTAAAACTCAAGCTAGTTTGGATTGAGC
AGTATTAATAGCACAAGTAGCTACCATCTAGGCAATTACAACAATCATTAGCGTTAACTT
TCACCTCAAACAAATTATGATAACAATTCTTTGAATACAATTAAACATGGACATGGTCAT
TTCCATTACTAAAGTAGCAGTCCTGATAACAGATATACTTAATCAAATAATCAAAGATCT
TAGACAGACTTAATTGGTCTTAAAAACAATTTTGAACTAAATTAATAATTATAGAGATAA
TAGTAATTCAGTAATCAAAACTAAAATTAGATCTCAAAGAAATAATTTGATCCAATTTAT
GAGTTCTTAAATAATGATGTTAGAACAATAAACAATCCAAACACAGGATCTATATCAACA
ACAAATAATGTCAACAGCATTGCAAGCAATAATAATAACAACAACAATAATAATTTAGGA
GGATAAATTATTAATCCATTAGAAAAAGGGTCTCGCTTTAGTGTGCCATAAGGAATAAGT
TCAAAAAATATGATAGATGATGAAATCGAAGATATGGAATAAGAAATATTAGGTACATAC
TTACCAACAGGAGGCAATGTTTCAAGAGTTCGTAACAGCAATAATAACAATACCCTTTCT
TAAAACAATAATGGTAGCACTCTTTTTGGAAATAACTAGGAAAACCAAGCAAGTATGTTC
TCTAACCCAAGAGGAGGAAATAGGGATAGAAATGTTAAAGATAATACTCTTAGTAATTAG
GATTCAAATACATTAGGATATGTTCCATCGGCTATTGCCAGAAATCAGCCTTCAAATCTA
GATATTTATAGGTTTGACCCTAAACCTCAAGCAAATACATATAATCCCAGTTTTGCTGCA
AATAATAATATGAACAATGGCAGTAAAATAAATAATGATATATATAATTTTGACAATGTA
ATTACAAATAACAGAAAAATTCAATTACCTCAATGA


>TTHERM_00267860(protein)
MNIFIKIINQIESKQRKKVNKKSIIKLINFLNKFKQLNIKKEIFKMEKYNIISEIGRGAF
GIVKKAQNKETKEIVAIKQMLQEYETWDECINLRELKSLRKLTHVNIIKLKEVFRVKKQL
SFVFEYVEKNIYKLYENAKQDGATSLPENTIKSIVYQIASALSYMHKHGFFHRDLKPENL
LISSDGIVKLIDFGLAREVRSRPPYTDYVSTRWYRAPEILLRSTHYNSPVDIFALGCIMA
ELYLMKPLFNGSSEIDQIQKITSVLGTPQKQDWPDGFILASTKYYTFPQYPAIPLSQVIP
NCPPDALNLISEMLKWDPQKRITAAKILQHPYFSNVELPEELTAESNSNQMIQSSNQPAT
LLGGASSNNAESVWNQSGNNNANLNQFQGNVNASQNVPANSRLGGHSNTANQNSSQFGLS
SINSTSSYHLGNYNNHQRQLSPQTNYDNNSLNTIKHGHGHFHYQSSSPDNRYTQSNNQRS
QTDLIGLKNNFELNQQLQRQQQFSNQNQNQISKKQFDPIYEFLNNDVRTINNPNTGSIST
TNNVNSIASNNNNNNNNNLGGQIINPLEKGSRFSVPQGISSKNMIDDEIEDMEQEILGTY
LPTGGNVSRVRNSNNNNTLSQNNNGSTLFGNNQENQASMFSNPRGGNRDRNVKDNTLSNQ
DSNTLGYVPSAIARNQPSNLDIYRFDPKPQANTYNPSFAANNNMNNGSKINNDIYNFDNV
ITNNRKIQLPQ


>TTHERM_00267860(gene)
ATGAATATATTCATTAAAATTATTAATTAAATAGAGAGCAAATAAAGAAAAAAAGTTAAT
AAGAAATCAATTATTAAATTAATTAATTTTCTAAATAAGTTTAAATAGTTAAATATTAAA
AAAGAAATATTCAAAATGGAAAAATATAATATAATTAGCGAGATTGGAAGAGGTGCTTTC
GGTATCGTTAAGAAAGCTTAAAATAAGGAAACGAAGGAAATTGTGGCTATTAAGTAAATG
TTGTAGGAGTATGAGACATGGGACGAGTGCATTAATTTAAGGGAATTGAAATCACTTAGG
AAATTGACACACGTGAATATCATAAAACTCAAAGAAGTGTTTCGCGTCAAGAAACAGCTT
TCGTTTGTTTTTGAATATGTTGAAAAGAATATATATAAACTATATGAAAATGCAAAGCAA
GATGGAGCAACATCCCTGCCAGAAAACACAATAAAAAGCATAGTTTATTAAATTGCCTCT
GCACTTTCATATATGCATAAACATGGTTTTTTCCACCGTGATTTGAAGCCAGAAAATCTC
CTGATCTCAAGCGATGGGATTGTAAAGTTGATTGACTTCGGATTAGCTCGTGAAGTGCGT
TCTCGTCCTCCATACACTGATTATGTTTCTACTAGATGGTATAGAGCACCCGAAATATTA
CTACGCTCTACTCATTATAATAGTCCAGTCGACATTTTCGCTTTAGGTTGCATCATGGCA
GAGTTATATTTAATGAAGCCGCTTTTCAACGGTTCTTCTGAAATAGATCAGATATAAAAA
ATAACTTCAGTTTTAGGCACTCCCCAAAAATAGGATTGGCCTGATGGGTTTATTTTAGCC
TCAACAAAGTATTATACTTTCCCTTAGTACCCAGCGATTCCTTTATCACAAGTTATTCCA
AATTGTCCTCCTGATGCACTTAATTTAATCTCAGAAATGCTTAAATGGGATCCATAAAAA
AGAATAACTGCTGCCAAGATACTTTAGCATCCATATTTTAGCAATGTAGAATTACCAGAA
GAATTAACAGCTGAAAGCAATAGCAATTAAATGATACAATCCTCTAATTAGCCAGCAACT
TTATTAGGGGGTGCCAGTTCAAACAATGCAGAGTCAGTTTGGAATCAGAGTGGCAACAAT
AATGCAAATCTAAACCAATTTTAAGGAAATGTAAATGCAAGTTAAAATGTTCCTGCAAAT
TCTCGTTTGGGTGGTCATTCTAATACAGCAAATTAAAACTCAAGCTAGTTTGGATTGAGC
AGTATTAATAGCACAAGTAGCTACCATCTAGGCAATTACAACAATCATTAGCGTTAACTT
TCACCTCAAACAAATTATGATAACAATTCTTTGAATACAATTAAACATGGACATGGTCAT
TTCCATTACTAAAGTAGCAGTCCTGATAACAGATATACTTAATCGTAATTTATTTATAAA
CTTTAAAAAATGTTTTATTCAAAATTCAAAGCAAATCAATAATAATGTTTGCTAATTAAT
TTTTATACATTCAATAAAGATAACTTAAAAATTAAATTCAAGCAATCAATCAAACAAACA
AACAAAATCAAATTTTCTTAAAGTAGTCAAGTTAAAGTCAGTCATTTTGCAAATATAAAC
GAAATTAAATTACAATCAATAATTAATTTCTTAACAAATACTAAAAACACCTATGTTGGT
TTTTGACTACTTAGTGCCTGCACAAACAAGATCTTTTTTTCAATAGATTGATTATTAAAT
TATTTTGATCCAGCAATTTGTCCATCCTGAAAAATTTTTACCAGCAAAATAATAAATTTA
TTATAAAATAAACTTCATAGATAAATTCCTAACTAAAATTTTAATTTTTAAGAAAATTTA
ACATTTTGTTAATGTTTTTGAATAAAATCAATTAAATTAGTTATTTCCTTTTTGAAGATA
GTTTAGAAGTAAAAATATTTAATATATTATTTAAAATAATAGAAATAATCAAAGATCTTA
GACAGACTTAATTGGTCTTAAAAACAATTTTGAACTAAATTAATAATTATAGAGATAATA
GTAATTCAGTAATCAAAACTAAAATTAGATCTCAAAGAAATAATTTGATCCAATTTATGA
GTTCTTAAATAATGATGTTAGAACAATAAACAATCCAAACACAGGATCTATATCAACAAC
AAATAATGTCAACAGCATTGCAAGCAATAATAATAACAACAACAATAATAATTTAGGAGG
ATAAATTATTAATCCATTAGAAAAAGGGTCTCGCTTTAGTGTGCCATAAGGAATAAGTTC
AAAAAATATGATAGATGATGAAATCGAAGATATGGAATAAGAAATATTAGGTACATACTT
ACCAACAGGAGGCAATGTTTCAAGAGTTCGTAACAGCAATAATAACAATACCCTTTCTTA
AAACAATAATGGTAGCACTCTTTTTGGAAATAACTAGGAAAACCAAGCAAGTATGTTCTC
TAACCCAAGAGGAGGAAATAGGGATAGAAATGTTAAAGATAATACTCTTAGTAATTAGGA
TTCAAATACATTAGGATATGTTCCATCGGCTATTGCCAGAAATCAGCCTTCAAATCTAGA
TATTTATAGGTTTGACCCTAAACCTCAAGCAAATACATATAATCCCAGTTTTGCTGCAAA
TAATAATATGAACAATGGCAGTAAAATAAATAATGATATATATAATTTTGACAATGTAAT
TACAAATAACAGAAAAATTCAATTACCTCAATGA