Identifiers and Description

Gene Model Identifier

TTHERM_00247100

Standard Name

None

Aliases

PreTt02505 | 21.m00336

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00247100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00485.19.997093137033517e-262hypothetical protein (1537 aa)
OxytrichaContig9370.0.0.g152.99915080840225e-45Nin one binding (NOB1) Zn-ribb
on like
DictyBaseDDB_G02798216.997498932278805e-30DDB_G0279821 on chromosome: 3
position 2586560 to 2588427
WormBaseWBGene000218438.00344477495519e-22status:Confirmed UniProt:Q9N
3D3 protein_id:CCD72990.1
SGDYOR056C0.000000000000005001692698841201NOB1 Essential nuclear protein
involved in proteasome matura
tion and synthesis of 40S ribo
somal subunits; required for c
leavage of the 20S pre-rRNA to
generate the mature 18S rRNA
Stentor CoeruleusSteCoe_189160.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00247100(coding)
ATGTGGGACCAAGATATTATAGCTGATAACAGAAATGATAATTCTAATTCCGATTAGAAT
AACAAAGACTAAACCAAAAAGCCTGTATTAGTACTTGATACTAATGCATTTATCAAATGC
TTAGATTTATAATCTCTTTACAATAAATATGATTTATACACAACTTAAGAAGTTAAGTTT
GAAATCCGTGATAAGAAGGCTAGAGAAAAATTCTTGACTCTACCTTTTGATATTTTGGTT
AAAGACCCATCAAAAACAGCTGTAGCTGCTGTAAGAAAATTTGCCACTACCACTGGTGAT
ATAGCTAGTTTGAGTTCTGTTGATATTAATGTAATCGCTCTCTGTTACACCTTCGCTGAA
GAAAATAAAACTGCCGATTTATTGAGAAAAGAACCTCCTGAGATCAAGGAAGCCTTTGCT
TAAAAAAATGTTCAAGACGGTTTAGAATCTCTCACTTTAGAAGAACAGTAGCAAAATCAA
AACTAAGAATAGAAGTAAGAACAAGGTGAATAAAAAGAATTAAAGGAAGATAGTAATGAA
AATTAAGATAATGATGAAGATTATGAAGATGATGATTAAGAAAAAAAAGATGATAAAGAC
GATGATGATGGATGGAATGTTGTCCCAGTTAAAGAAAAAAAGAAAGTAATAAGCAAACCT
AAGAATGAATTTGGAACTGGTTGGAATTTTGTAGGACCTAAAACTAATGAAGAAAAATAA
TAATAAACTTAAGAAAAAGAAAATGTTGAAGGTGAATAAAACAAGGAAGCAGTTTAAGAA
TAAAAAAATTAAAAGCCAAAGAAGCAAAAAGATGAAGAAAGTGATGATGAAGATGATGGC
GAAGGTTGGATTAACACTGAAAACATTCACTTATACAAAGAATAAGGTAACTAGAAGCTC
GAAAACACTGGCAGCTAAATTGGTGTTTCTATCTTGACTGCTGATTTTGCCATGCAGAAT
GTTGCATTATAAATGGGTATTCCTTTAGTTTCTATAGATGGTATGTTAATCACTAGAGCC
AAGCGTTTTATTTTAGAGTGCTTTGGTTGCTAACATTTATGCAAAGAAATGACAAAAAAA
TTCTGTCCAAAGTGCAAAAACCCTACTTTACTTAAGGTCTCTTGCAGCTTTGAAGCTGAT
GGCTCAATAAAATTATACAGAAAGAAGGGATTCAAATTAAATACTGCTGGTTTCATTTAT
TCCATTCCAAAGCCTTAAATTGGTAAACAAGCTAACAATATTGTTTTAAGAGAAGATGAT
TTATTAAAGGGTAATAAATTAACATAATGTAAGATAGCCTAAAAATAATAAGAAAAAGAA
TTTAGTAGAAATATGTTAGAGTTTGAAAATGGTTTCACTTTAGATGATATCAAGCACAAG
CAACACCATAACCATAATTTAGAATTCGGATATGGTAGATTAAACCCCAATAATGTATCT
CAAATGAAAAGACATAAGAGAAAGTGA


>TTHERM_00247100(protein)
MWDQDIIADNRNDNSNSDQNNKDQTKKPVLVLDTNAFIKCLDLQSLYNKYDLYTTQEVKF
EIRDKKAREKFLTLPFDILVKDPSKTAVAAVRKFATTTGDIASLSSVDINVIALCYTFAE
ENKTADLLRKEPPEIKEAFAQKNVQDGLESLTLEEQQQNQNQEQKQEQGEQKELKEDSNE
NQDNDEDYEDDDQEKKDDKDDDDGWNVVPVKEKKKVISKPKNEFGTGWNFVGPKTNEEKQ
QQTQEKENVEGEQNKEAVQEQKNQKPKKQKDEESDDEDDGEGWINTENIHLYKEQGNQKL
ENTGSQIGVSILTADFAMQNVALQMGIPLVSIDGMLITRAKRFILECFGCQHLCKEMTKK
FCPKCKNPTLLKVSCSFEADGSIKLYRKKGFKLNTAGFIYSIPKPQIGKQANNIVLREDD
LLKGNKLTQCKIAQKQQEKEFSRNMLEFENGFTLDDIKHKQHHNHNLEFGYGRLNPNNVS
QMKRHKRK


>TTHERM_00247100(gene)
ATGTGGGACCAAGATATTATAGCTGATAACAGAAATGATAATTCTAATTCCGATTAGGTA
TAAATTATAAATACTTTTATTAAATTAGAACTTATAAAATACTATTAGTTCCTTTAGTTT
ACAATTTCCTTTACTTTTAAAATAGAATAACAAAGACTAAACCAAAAAGCCTGTATTAGT
ACTTGATACTAATGCATTTATCAAATGCTTAGATTTATAATCTCTTTACAATAAATATGA
TTTATACACAACTTAAGAAGTTAAGTTTGAAATCCGTGATAAGAAGGCTAGAGAAAAATT
CTTGACTCTACCTTTTGATATTTTGGTTAAAGACCCATCAAAAACAGCTGTAGCTGCTGT
AAGAAAATTTGCCACTACCACTGGTGATATAGCTAGTTTGAGTTCTGTTGATATTAATGT
AATCGCTCTCTGTTACACCTTCGCTGAAGAAAATAAAACTGCCGATTTATTGAGAAAAGA
ACCTCCTGAGATCAAGGAAGCCTTTGCTTAAAAAAATGTTCAAGACGGTTTAGAATCTCT
CACTTTAGAAGAACAGTAGCAAAATCAAAAGTAGAAGAAATTATAATTTTGCCTTTAAAA
TATAAAAAAATTAATTTTTTCTTTATAAAATGAATGAAAAATACTTCTTAAAAAAAATAA
TTAACATTTTATTCAATTTTTTAATTGAATATTCCATTTAATTCAACTAATTCTATTTTA
TTTTGAACTAGCTAAGAATAGAAGTAAGAACAAGGTGAATAAAAAGAATTAAAGGAAGAT
AGTAATGAAAATTAAGATAATGATGAAGATTATGAAGATGATGATTAAGAAAAAAAAGAT
GATAAAGACGATGATGATGGATGGAATGTTGTCCCAGTTAAAGAAAAAAAGAAAGTAATA
AGCAAACCTAAGAATGAATTTGGAACTGGTTGGAATTTTGTAGGACCTAAAACTAATGAA
GAAAAATAATAATAAACTTAAGAAAAAGAAAATGTTGAAGGTGAATAAAACAAGGAAGCA
GTTTAAGAATAAAAAAATTAAAAGCCAAAGAAGCAAAAAGATGAAGAAAGTGATGATGAA
GATGATGGCGAAGGTTGGATTAACACTGAAAACATTCACTTATACAAAGAATAAGGTAAC
TAGAAGCTCGAAAACACTGGCAGCTAAATTGGTGTTTCTATCTTGACTGCTGATTTTGCC
ATGCAGGTAAATATCATATTCTTTATTTACTATTTATTATATATATCATCTTAAAGCAAA
GTATTGAAAGGATACTTTCAAAAATGGCTTTAATATTTTTACAATAATGATAAGTAAACA
ATTTATTGATCAATCAAGTTAGTTTTTATTATTTTAGTTTTGGCTAAAATAATCAAAAAT
ACAAATTTAATTAATTATTTACATTCATAAATAATGATAAATATTCAGCTAGATTGATTT
TTATGTTTATTTCAAATGAAACCTTTGTTTGAATTGTGTTTTATAGAATATAATTTTAAT
TTGTTTTTTTATTAATATAAAGAATGTTGCATTATAAATGGGTATTCCTTTAGTTTCTAT
AGATGGTATGTTAATCACTAGAGCCAAGCGTTTTATTTTAGAGTGCTTTGGTTGCTAACA
TTTATGCAAAGAAATGACAAAAAAATTCTGTCCAAAGTGCAAAAACCCTACTTTACTTAA
GGTCTCTTGCAGCTTTGAAGCTGATGGCTCAATAAAATTATACAGAAAGAAGGGATTCAA
ATTAAATACTGCTGGTTTCATTGTAAATATTTTAAATTAAATTTTTTTCAAATTAATTTA
CAGATTTATTGAAATAAATTTTTTTTTCACTGGTTAATATAATCTTATTAAAATAATTTA
GTATTCCATTCCAAAGCCTTAAATTGGTAAACAAGCTAACAATATTGTTTTAAGAGAAGA
TGATTTATTAAAGGGTAATAAATTAACATAATGTAAGATAGCCTAAAAATAATAAGAAAA
AGAATTTAGTAGAAATATGTTAGAGTTTGAAAATGGTTTCACTTTAGATGATATCAAGCA
CAAGCAACACCATAACCATAATTTAGAATTCGGATATGGTAGATTAAACCCCAATAATGT
ATCTCAAATGAAAAGACATAAGAGAAAGTGA