Identifiers and Description

Gene Model Identifier

TTHERM_00242500

Standard Name

None

Aliases

PreTt18987 | 20.m00451 | 3706.m00215

Description

nucleolar GTP-binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF08155 ) NOGCT (NUC087) domain
  • ( TIGR02729 ) Obg family GTPase CgtA
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00450 ) tRNA modification GTPase TrmE
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF06858 ) Nucleolar GTP-binding protein 1 (NOG1)
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00242500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_430
Tetrahymena borealisEI9_07755.19.997093137033517e-262hypothetical protein (655 aa)
OxytrichaContig10756.0.g1119.997093137033517e-262Nucleolar GTP-binding protein
1 (NOG1)
DictyBaseDDB_G02854657.99900164028722e-180nog1 on chromosome: 4 position
3263032 to 3265230
SGDYPL093W6.002196208547375e-166NOG1 Putative GTPase that asso
ciates with free 60S ribosomal
subunits in the nucleolus and
is required for 60S ribosomal
subunit biogenesis; constitue
nt of 66S pre-ribosomal partic
les; member of the ODN family
of nucleolar G-proteins
WormBaseWBGene000202972.0004460046616782e-163Probable nucleolar GTP-binding
protein 1 status:Confirmed
UniProt:O44411 protein_id:
CCD73980.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00242500(coding)
ATGTAGTATATTTTTAAGGGTATCAAGACTATTCCTGCTTCTAAGGACATGATCAACATT
GTCCTTTCCAAGACTTAAAGAAAGACTCCTACCGTTGTTCATCCAGGCTATTCCATTGGT
CGTATTAGAGGTTTCTACATGCGTAAGATTAAGTTCACTTAAGATACTATGCATGAAAAA
TTCAATGACATTTTGAATGGTTTCCCTAAATTGGATGACATCCATCCCTTCTTCGCTGAT
TTATTCAATGTCCTTTATGACAAGGATCACTATAAGCTTGCCTTGGGTCACGTTCATTCT
TGCATGAACTTGGTTGACAACATTTGCACAGATTACGTTAGACTTATCAAGTATGGTGAC
TCTCTCTATCGTTGCAAGCAATTGAAGAAAGCTTGTTTGGGAAGAATTTGCACAATCATA
AAGAAGTTAAATAGCAGCTTAAATTATTTGGAAGAAGTCAGAAAACATTTAGCAAGATTG
CCTTCAGTTAACCCCTTCGAAAGAACTTTAATGATTACTGGTTACCCCAATGTCGGTAAA
AGTAGTTTCATCAATTAAATCACTAAGGCTAACGTTGAAGTCTAAAGTTATCCTTTCACA
ACTTAATCACTTTATGTTGGTCATACTGAATACCAAAATGTCAGATGGTAGGTTATTGAT
TCACCTGGTATTCTTGATCATCCTTTAGAACAACGTAACACAATTGAAATGTAAAGTATT
ACTGCTTTAGCTCACTTGAAGGCTTGCATTCTCTTCTTTATTGATTTATCTGAATAATGC
TCATACAGTATTGAATAATAAGTAAGCTTATTCAACTCTATTAAGCCTCTCTTTAAGAAT
AAGCCTCTTTGCATCGTTCTCAGTAAGTGCGATTTGAAATCTTTTGAAGATCTTTCTCAA
GAAAATAAGGATATCCTTAACAGCCTTGCTAAGGATTAAAATGTATCTCTTCTTTAAATG
TCCAATAAAACTGGTGAAGGTATTGAAAACCTCAAGGTCCAAGCTTGCGAAACTCTCTTA
AAGCATCGTGACGGTTAAAAAATTGAATAACTTTCTGGTGGTAACCAAATTTTAAAGAGA
GAAGAAGAAGTTTTAAGAGGTTTACATGTTGCTAAACCTACTAAAGTTAGAGATAGCAAT
GTAGTAAGAGCTCCTGTCATCCCCTAAACTGTCAAGAGTGGTATTAAGAATGAAAAGCCT
ACTCTCAAAGAAATTCAAGAAGAACATGGTGGTGCTGGTGTTTTCAACTTCCCATTATAA
GAACATTTCGATTTAGCCAACCCTGAATGGAAGTATGATGCTATACCTGAAATCATGGAC
GGTAAAAACATTGCTGATTATGTTGACCCTGATATTCTTGAAAAACTTGAAGAACTTGAA
AGAGAAGAAGAAATGCTTGAAAAAGCTAGAGAAGAAAAGGGAGACATGAGTGAAGAAAGC
GATGGCGATTTACCTGATGAATACTATGAAGCTCATGAAATTGTCCAATCAAAATAAAAA
TTACTTAAAATCGAACACAAGTTAAAGAGACACACAACTGCTCATGTTCATAAGGAAGCT
TTAAGTGAAGTTAAAAAGGATCTCGAAACTAAAGGTATTGATTCTACTAAGCTTGAATAA
AGAGTTCTTGCCAAGAGATAACCAAGAAGATTACTTGATCAAATTAAAGACGAAAAAGAT
ATTGAAGATGATGATGAAGATATCATGGAAGATGAAGGTGTTGCTGATAGAAAGAAGATT
GAAAAGAAATTAGAAAAGAAGTAAAGATCTGCCTCTAGATCAAGATCTAAAGGTATCAAT
CCCAATCCTATTTTAACTCCTGCTGATAAGGCTATGCAAAGACTTAAATACAAGATTGAA
AAGACTTGGTCTGGTATGGCTGGTGAAGCTGACAGAAGTATTGCCTAAAAGATGCCCAAG
CATCTTTTCTCTGGTAAGAGAAAACAAAAAGCAGATAGACGTTGA


>TTHERM_00242500(protein)
MQYIFKGIKTIPASKDMINIVLSKTQRKTPTVVHPGYSIGRIRGFYMRKIKFTQDTMHEK
FNDILNGFPKLDDIHPFFADLFNVLYDKDHYKLALGHVHSCMNLVDNICTDYVRLIKYGD
SLYRCKQLKKACLGRICTIIKKLNSSLNYLEEVRKHLARLPSVNPFERTLMITGYPNVGK
SSFINQITKANVEVQSYPFTTQSLYVGHTEYQNVRWQVIDSPGILDHPLEQRNTIEMQSI
TALAHLKACILFFIDLSEQCSYSIEQQVSLFNSIKPLFKNKPLCIVLSKCDLKSFEDLSQ
ENKDILNSLAKDQNVSLLQMSNKTGEGIENLKVQACETLLKHRDGQKIEQLSGGNQILKR
EEEVLRGLHVAKPTKVRDSNVVRAPVIPQTVKSGIKNEKPTLKEIQEEHGGAGVFNFPLQ
EHFDLANPEWKYDAIPEIMDGKNIADYVDPDILEKLEELEREEEMLEKAREEKGDMSEES
DGDLPDEYYEAHEIVQSKQKLLKIEHKLKRHTTAHVHKEALSEVKKDLETKGIDSTKLEQ
RVLAKRQPRRLLDQIKDEKDIEDDDEDIMEDEGVADRKKIEKKLEKKQRSASRSRSKGIN
PNPILTPADKAMQRLKYKIEKTWSGMAGEADRSIAQKMPKHLFSGKRKQKADRR


>TTHERM_00242500(gene)
ATGTAGTATATTTTTAAGGGTATCAAGACTATTCCTGCTTCTAAGGACATGATCAACATT
GTCCTTTCCAAGACTTAAAGAAAGACTCCTACCGTTGTTCATCCAGGCTATTCCATTGGT
CGTATTAGAGGTTTCTACATGCGTAAGATTAAGTTCACTTAAGATACTATGCATGAAAAA
TTCAATGACATTTTGAATGGTTTCCCTAAATTGGATGACATCCATCCCTTCTTCGCTGAT
TTATTCAATGTCCTTTATGACAAGGATCACTATAAGCTTGCCTTGGGTCACGTTCATTCT
TGCATGAACTTGGTTGACAACATTTGCACAGATTACGTTAGACTTATCAAGTATGGTGAC
TCTCTCTATCGTTGCAAGCAATTGAAGAAAGCTTGTTTGGGAAGGTAATTTAACAAATTC
TCTTAAGAGAGTTTATTTTTTAAATATTTGAATCCATTTTAACTTTTTGTTCTCTCCTGC
TTCAAGCAATAATAAAAAAACTGTATTTTTTATCTTGCTTGATCCTATTAATTAACTCCT
ACATAGAATAAAATAAACATAAAAAAAATAAGTAACAACAATTATGAGTAAAACTCATTA
ATAAGAATTAATAATACTTTAATGATGTTAATTAAAAAGGCTATCAGTTTTTTAGGAGTT
AAGAATGAGAGGAGATAATTTTTTTAGTTCTATTTGAATCAACTTCATAATTTTTTATAA
ATAATTTGTAGAATTTGCACAATCATAAAGAAGTTAAATAGCAGCTTAAATTATTTGGAA
GAAGTCAGAAAACATTTAGCAAGATTGCCTTCAGTTAACCCCTTCGAAAGAACTTTAATG
ATTACTGGTTACCCCAATGTCGGTAAAAGTAGTTTCATCAATTAAATCACTAAGGCTAAC
GTTGAAGTCTAAAGTTATCCTTTCACAACTTAATCACTTTATGTTGGTCATACTGAATAC
CAAAATGTCAGATGGTAGGTTATTGATTCACCTGGTATTCTTGATCATCCTTTAGAACAA
CGTAACACAATTGAAATGTAAAGTATTACTGCTTTAGCTCACTTGAAGGCTTGCATTCTC
TTCTTTATTGATTTATCTGAATAATGCTCATACAGTATTGAATAATAAGTAAGCTTATTC
AACTCTATTAAGCCTCTCTTTAAGAATAAGCCTCTTTGCATCGTTCTCAGTAAGTGCGAT
TTGAAATCTTTTGAAGATCTTTCTCAAGAAAATAAGGATATCCTTAACAGCCTTGCTAAG
GATTAAAATGTATCTCTTCTTTAAATGTCCAATAAAACTGGTGAAGGTATTGAAAACCTC
AAGGTCCAAGCTTGCGAAACTCTCTTAAAGCATCGTGACGGTTAAAAAATTGAATAACTT
TCTGGTGGTAACCAAATTTTAAAGAGAGAAGAAGAAGTTTTAAGAGGTTTACATGTTGCT
AAACCTACTAAAGTTAGAGATAGCAATGTAGTAAGAGCTCCTGTCATCCCCTAAACTGTC
AAGAGTGGTATTAAGAATGAAAAGCCTACTCTCAAAGAAATTCAAGAAGAACATGGTGGT
GCTGGTGTTTTCAACTTCCCATTATAAGAACATTTCGATTTAGCCAACCCTGAATGGAAG
TATGATGCTATACCTGAAATCATGGACGGTAAAAACATTGCTGATTATGTTGACCCTGAT
ATTCTTGAAAAACTTGAAGAACTTGAAAGAGAAGAAGAAATGCTTGAAAAAGCTAGAGAA
GAAAAGGGAGACATGAGTGAAGAAAGCGATGGCGATTTACCTGATGAATACTATGAAGCT
CATGAAATTGTCCAATCAAAATAAAAATTACTTAAAATCGAACACAAGTTAAAGAGACAC
ACAACTGCTCATGTTCATAAGGAAGCTTTAAGTGAAGTTAAAAAGGATCTCGAAACTAAA
GGTAAACAATTAAAAAATTTGATTTAAAAAAAAAGAAGAACAAGAATTATTATTGAGTTA
TTAATAGAAACAGAAATAATTTAAAAAAATTTTTAGTTTAAAGCGAGTTAATTAATTGTT
AAATTTTATAATTATAGGTATTGATTCTACTAAGCTTGAATAAAGAGTTCTTGCCAAGAG
ATAACCAAGAAGATTACTTGATCAAATTAAAGACGAAAAAGATATTGAAGATGATGATGA
AGATATCATGGAAGATGAAGGTGTTGCTGATAGAAAGAAGATTGAAAAGAAATTAGAAAA
GAAGTAAAGATCTGCCTCTAGATCAAGATCTAAAGGTATCAATCCCAATCCTATTTTAAC
TCCTGCTGATAAGGCTATGCAAAGACTTAAATACAAGATTGAAAAGACTTGGTCTGGTAT
GGCTGGTGAAGCTGACAGAAGTATTGCCTAAAAGATGCCCAAGCATCTTTTCTCTGGTAA
GAGAAAACAAAAAGCAGATAGACGTTGA