Identifiers and Description

Gene Model Identifier

TTHERM_00242189

Standard Name

None

Aliases

3706.m01528

Description

GTP-binding protein enga

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF04548 ) AIG1 family
  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( PF02492 ) CobW/P47K family protein
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR03156 ) GTP-binding protein HflX
  • ( TIGR00450 ) tRNA modification GTPase TrmE
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF02263 ) Guanylate-binding protein, N-terminal domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00242189

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07776.19.997093137033517e-262GTP-binding protein enga (579
aa)
OxytrichaContig16524.0.g893.000328303707556e-12650S ribosome-binding GTPase
Stentor CoeruleusSteCoe_338438.628801156620959e-60
DictyBaseDDB_G02792593.0000451088882257e-25DDB_G0279259 on chromosome: 3
position 1848643 to 1851168
SGDYMR023C0.000000000500206551404915MSS1 Mitochondrial protein, fo
rms a heterodimer complex with
Mto1p that performs the 5-car
boxymethylaminomethyl modifica
tion of the wobble uridine bas
e in mitochondrial tRNAs; simi
lar to human GTPBP3
WormBaseWBGene000095570.0000000400154582995175status:Confirmed UniProt:Q9X
TZ1 protein_id:CAB07393.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00242189(protein)
MINLFRYQNKFLQQASKQTQAINKLASVCNKGNKFSSLSLSTAYKFCSFENNDNFSRKDD
IYTISFVGRPNVGKSSLFNKLSEDGMNKALTDRMPGLTRDRKEQITTILGYPLRLVDTAG
VEKLPKDPHRFKPTQIKQKMMDQTVQALIYSDLTLFVLDARQGITARDKELAKWLKRRLL
QDKSEENVKKMNENATDLDKDIFIKKLILLANKADNETIIEDSNIMNDVYKLGLGDPLFV
SAHQGDGLIDLLRIIDDEVPQDFKDNFLLKKQRRLERFQKIRSNQREEILELMRKKELPD
DIDITAWEREFDKANPDPENNSDLDSDNEFDPVETLQNTKDDLLKEDKGVTSQNDKKKKP
IQISIIGRSNCGKSTLVNNLLQEERVIADDLAGTTRDAIKVQWAYRGRKIDLVDTSGIDK
KITKVSEVEKKIQNDTIRAVKQSHVVVCMIDALRAFQSQDLSLAQYVCDQGRALILVVNK
WDLVPEEYKKKALRYMNNQLEKHLAQVRGVYLHCMSAKNNGNDKEEMMNYVLKAYEKWNI
RISTGMLNDWLNRFKKVQNAPTEGGNKLKIRFVSQVKSRPPTFVVFVNDKVLFKPNYMRF
MRQKMAEEFGLQGTPLRFLVRETDQKVKNPKKLSEKYIEHIRMKKIVSRYKRTLKIAKQK
LSKFNFNKTK


>TTHERM_00242189(coding)
ATGATTAATTTATTTAGGTACCAAAATAAATTTTTATAATAGGCTTCCAAACAAACATAA
GCAATCAATAAATTAGCTAGCGTTTGCAATAAAGGGAATAAATTTAGTTCATTAAGTTTA
AGTACTGCTTATAAATTCTGCTCTTTTGAAAATAACGATAATTTTTCAAGAAAAGATGAT
ATTTATACTATCTCTTTTGTAGGTAGGCCTAATGTTGGTAAAAGCTCTTTATTTAACAAA
TTAAGTGAAGACGGAATGAATAAGGCATTAACAGATAGAATGCCTGGTTTGACAAGAGAC
AGAAAAGAATAAATAACAACTATTTTAGGATATCCACTTCGTTTAGTAGACACAGCTGGT
GTTGAAAAACTCCCAAAAGATCCTCATAGATTTAAGCCTACTTAAATTAAGTAAAAGATG
ATGGATCAAACAGTGTAAGCTTTAATTTACAGTGACTTGACTCTCTTTGTACTCGATGCA
AGATAGGGAATTACTGCAAGAGATAAAGAATTAGCAAAATGGTTAAAAAGGAGATTATTG
CAAGATAAATCTGAAGAAAATGTAAAAAAAATGAATGAAAATGCTACTGATTTAGACAAA
GATATTTTTATTAAAAAACTAATTTTGCTTGCTAACAAAGCAGACAATGAAACAATTATA
GAAGATTCTAATATCATGAATGATGTTTATAAGTTAGGTTTGGGAGATCCTCTTTTTGTT
TCTGCACATTAAGGTGACGGTTTAATTGATTTGCTACGTATAATTGATGATGAAGTTCCA
CAAGACTTCAAAGACAATTTCTTACTTAAAAAGCAGCGTCGTTTAGAGAGATTCTAAAAA
ATTAGAAGCAATTAAAGAGAAGAAATATTGGAATTGATGAGAAAAAAAGAATTACCAGAT
GATATTGATATTACTGCATGGGAGAGAGAATTTGATAAAGCTAATCCAGATCCAGAAAAC
AATTCAGATTTAGATAGTGATAACGAATTTGATCCTGTAGAAACTCTGTAAAACACAAAA
GATGATCTATTGAAAGAAGATAAAGGTGTTACAAGTTAAAACGATAAGAAGAAAAAGCCA
ATTTAAATTTCAATTATTGGACGTTCAAATTGTGGTAAATCTACTTTGGTTAACAATCTT
CTTTAAGAAGAGCGTGTTATAGCTGATGATTTAGCTGGAACAACAAGAGATGCAATTAAA
GTTTAATGGGCTTATAGAGGAAGAAAGATAGATTTGGTAGATACTTCAGGTATAGATAAG
AAGATCACAAAAGTGTCAGAAGTAGAAAAGAAAATTTAAAATGACACAATAAGAGCAGTA
AAATAATCACATGTTGTTGTGTGCATGATTGATGCACTTCGTGCTTTCCAGTCTTAAGAT
TTATCACTTGCATAGTATGTTTGTGATTAAGGAAGAGCTCTCATTCTTGTAGTCAATAAA
TGGGATCTCGTTCCTGAAGAATACAAAAAAAAGGCTCTAAGATATATGAATAACTAATTG
GAAAAGCACTTAGCTTAGGTCAGAGGTGTTTACTTGCATTGCATGAGTGCAAAAAATAAT
GGAAACGATAAAGAAGAAATGATGAATTATGTTTTAAAAGCCTATGAAAAATGGAATATT
CGTATTTCAACAGGTATGCTAAATGATTGGTTAAATCGCTTTAAAAAAGTTCAAAATGCT
CCTACAGAAGGTGGTAACAAACTTAAAATTAGATTTGTTTCATAAGTAAAATCTCGTCCT
CCTACTTTTGTAGTTTTTGTTAATGATAAAGTCCTCTTCAAACCAAATTACATGAGATTC
ATGCGTTAAAAAATGGCTGAAGAATTTGGTTTATAAGGTACTCCACTTAGATTCTTGGTC
AGAGAAACTGATTAAAAAGTTAAAAATCCTAAAAAACTCTCAGAAAAATATATAGAACAC
ATCAGAATGAAAAAAATAGTAAGTAGATATAAAAGAACTTTAAAAATAGCAAAGCAAAAA
TTAAGTAAATTTAACTTCAACAAAACAAAATGA


>TTHERM_00242189(gene)
ATGATTAATTTATTTAGGTACCAAAATAAATTTTTATAATAGGCTTCCAAACAAACATAA
GCAATCAATAAATTAGCTAGCGTTTGCAATAAAGGGAATAAATTTAGTTCATTAAGTTTA
AGTACTGCTTATAAATTCTGCTCTTTTGAAAATAACGATAATTTTTCAAGAAAAGATGAT
ATTTATACTATCTCTTTTGTAGGTAGGCCTAATGTTGGTAAAAGCTCTTTATTTAACAAA
TTAAGTGAAGACGGAATGAATAAGGCATTAACAGATAGAATGCCTGGTTTGACAAGAGAC
AGAAAAGAATAAATAACAACTATTTTAGGATATCCACTTCGTTTAGTAGACACAGCTGGT
GTTGAAAAACTCCCAAAAGATCCTCATAGATTTAAGCCTACTTAAATTAAGTAAAAGATG
ATGGATCAAACAGTGTAAGCTTTAATTTACAGTGACTTGACTCTCTTTGTACTCGATGCA
AGATAGGGAATTACTGCAAGAGATAAAGAATTAGCAAAATGGTTAAAAAGGAGATTATTG
CAAGATAAATCTGAAGAAAATGTAAAAAAAATGAATGAAAATGCTACTGATTTAGACAAA
GATATTTTTATTAAAAAACTAATTTTGCTTGCTAACAAAGCAGACAATGAAACAATTATA
GAAGATTCTAATATCATGAATGATGTTTATAAGTTAGGTTTGGGAGATCCTCTTTTTGTT
TCTGCACATTAAGGTGACGGTTTAATTGATTTGCTACGTATAATTGATGATGAAGTTCCA
CAAGACTTCAAAGACAATTTCTTACTTAAAAAGCAGCGTCGTTTAGAGAGATTCTAAAAA
ATTAGAAGCAATTAAAGAGAAGAAATATTGGAATTGATGAGAAAAAAAGAATTACCAGAT
GATATTGATATTACTGCATGGGAGAGAGAATTTGATAAAGCTAATCCAGATCCAGAAAAC
AATTCAGATTTAGATAGTGATAACGAATTTGATCCTGTAGAAACTCTGTAAAACACAAAA
GATGATCTATTGAAAGAAGATAAAGGTGTTACAAGTTAAAACGATAAGAAGAAAAAGCCA
ATTTAAATTTCAATTATTGGACGTTCAAATTGTGGTAAATCTACTTTGGTTAACAATCTT
CTTTAAGAAGAGCGTGTTATAGCTGATGATTTAGCTGGAACAACAAGAGATGCAATTAAA
GTTTAATGGGCTTATAGAGGAAGAAAGATAGATTTGGTAGATACTTCAGGTATAGATAAG
AAGATCACAAAAGTGTCAGAAGTAGAAAAGAAAATTTAAAATGACACAATAAGAGCAGTA
AAATAATCACATGTTGTTGTGTGCATGATTGATGCACTTCGTGCTTTCCAGTCTTAAGAT
TTATCACTTGCATAGTATGTTTGTGATTAAGGAAGAGCTCTCATTCTTGTAGTCAATAAA
TGGGATCTCGTTCCTGAAGAATACAAAAAAAAGGCTCTAAGATATATGAATAACTAATTG
GAAAAGCACTTAGCTTAGGTCAGAGGTGTTTACTTGCATTGCATGAGTGCAAAAAATAAT
GGAAACGATAAAGAAGAAATGATGAATTATGTTTTAAAAGCCTATGAAAAATGGAATATT
CGTATTTCAACAGGTATGCTAAATGATTGGTTAAATCGCTTTAAAAAAGTTCAAAATGCT
CCTACAGAAGGTGGTAACAAACTTAAAATTAGATTTGTTTCATAAGTAAAATCTCGTCCT
CCTACTTTTGTAGTTTTTGTTAATGATAAAGTCCTCTTCAAACCAAATTACATGAGATTC
ATGCGTTAAAAAATGGCTGAAGAATTTGGTTTATAAGGTACTCCACTTAGATTCTTGGTC
AGAGAAACTGATTAAAAAGTTAAAAATCCTAAAAAACTCTCAGAAAAATATATAGAACAC
ATCAGAATGAAAAAAATAGTAAGTAGATATAAAAGAACTTTAAAAATAGCAAAGCAAAAA
TTAAGTAAATTTAACTTCAACAAAACAAAATGA