Identifiers and Description

Gene Model Identifier

TTHERM_00242010

Standard Name

None

Aliases

PreTt18939 | 20.m00403 | 3706.m00167

Description

TRAF-type zinc finger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07975 ) TFIIH C1-like domain
  • ( PF02176 ) TRAF-type zinc finger
  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00242010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07799.19.997093137033517e-262TRAF-type zinc finger family p
rotein (763 aa)
OxytrichaContig21582.0.g892.0002795641672355e-21TRAF-type zinc finger
DictyBaseDDB_G03475510.00000000006996681903814525DDB_G0347551 on chromosome: 5
position 4720437 to 4722491
WormBaseWBGene000066120.00020003864201578029locus:trf-1 status:Partially
_confirmed UniProt:G5EG80
protein_id:CAB07615.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00242010(coding)
ATGAATAGTTAAAGCACGAATACTAGTTCAAATAGTAATAATAATCATAATAACAACTCT
AGTAGCAGTAACAGAATTCTGCATGATTAATTTTTTTAAATTAGATTGGCAAGGCAAGGT
CAGGATATGAATTTAAATTCTAATCAGATAGCTAATAGTCAACCTGCCAATTTTAACTTT
TATAATTATCCTGCATATAATATGCAATAACCTGCAATTAACAGCAATCCTCTAAATCCT
AATTTGGTAAATAATAGAGTCATTTTTATGAGGAGAGATGATTTAGAGAGAAATGGTTAG
AGGAATTAGTAGCCAAGTAGGTCTACAAGCTATTCGTATATAACTAACAGCAACAGAGGA
GCTAATCATCTAATTATTGAAAGCTAAGTCATTAACATGAGTCCGATCGGAATTTCTTCT
TCAAATCAATAAAGCAACATTAATAGTAGCAATATTCTTGACTCAGATAATGATAGTACC
ATCATTTTTTAGAATCAAGAAGAGAAGGATTTTATTTTTGGAACAGAAAATCTTGCTGTT
TCAACTGAAAATATTGATTTTGTTAAATGTACTATTTGTATGCATATTTATTAGAATCCT
ATTGCTTGTGGAAATTGCTTAAATCACTTCTGCACAGTTTGCATTAGAGAGTGGCTTATT
AGGCATCCTAATACCTGTCCTCTTTGCAAGAATTTTAGAGAGATGCGTTGTGTGCCTATG
TTAAAGAATATGCTTGATAAGCTATAATTTTTCTGCACAAATAAGAAAAACGGATGTGAA
GAAATAATAAGATATGAGTAAGTTATTAAGCACGAAGATAGCTGCGAATATAAAATAGAA
ATTTGTCCTGTCTTAGGCTGTGGATAGTAGATGATTAAGAAAATATTAGATAAGCACATT
CAAGAAGAATGTGAGTATGTGCTTTCTAAGTGTCGCTGGTGTGAATAATAAATCAAAAAA
AAGATAATTGAAGAACATGAGGAGGCATGCGATTAGAAGGAAATAATTTGTGATTTATGT
GGTGATATTTTCTAATTTAAAGACTAAATGGATCATAATTAGAAATGTCCTGAATTAATC
TTAGATTGCTCTTGGTGCAGTAAAAAGATCAAATAAAAAGAAATTAGAGATCATGAAGAC
TGCTGTGGAGAAAGAATAGTCAGATGTTAAGGCTGCAACTATGAGTGCTGCTTGAATGAT
CACTTCCTTCACAATCAGACATGCCAGGAAATCCCAGTCTTATGTCATAGGTGTTAAACA
AAAATGAAACGCCGAGAACTAGCAGTCCATACCATAGAATCTTGCATTGAAAATATCTAA
AAGACATCCAGCTAAAAAATATACCAATTAGAAAATGAAAATCGTGAATTAAAACGACAA
TTAACATCAATTCAAAATGAAAATTAACAAGAAATAATAAAAATTAACAACATAATAACA
AAAAATAATTAAAATCAACCTTTCTAGTTTTCATAGATTTACAAAGATCAAGATATATTT
GTTAATCAACCTGCAAATATAGCACTTGTTAGAGAGTACAAAAAGAAGAGAAGAGACAGA
TTTGTTATTGTTGATTTTCATAAACCTCTTTTAGATACTAATCAACAGATTACCTTCAAA
ATCTTGTCTCGTAGATCTGATTGGTTTGCAATTGGAATTTGTGACGAATCTAATGTTTAT
TCCTCACGTCGCTACCACGATATTGGTCATCTGTCTTATCTCATATCGGCAAACGGAATA
CTCTACTCTTCTCATAGTGCCAATGAAAATTGGTAAAATAGGTCTTTCTAGATTGAAATA
GACAATGTAATATCAATCTAATTTTTATTCAAACCAGGTCCTTCGGCTCTATAAAATTCT
TCGAATGCCTAATCATAGAATAACATGTAAAATATAAATTCATCAAGCAACCAAGTAGTT
CCTGGCAATAGCGAATAGAATCCAATAAACAATAACAATTTTGCAAGCAGTGTATAAAAT
AGTTAATTAAATAATTAAAATAATAATGTAAATAGTAATAATGCTGCTAATATAAATATG
AATTCAAATAATGAAGAAATGAGGCTTAATGAGATGAACTCTTAAAACAGCTAAAATATT
AATAATAATCAAGGCAATATCAATAATCAAAGCCATTTGATTGGCTCAGAAATGAAGTTA
AAATTTATAAATCACACTGAAAATTAAGAACTTATAATTAACCTAGATAGCAAGCAAATC
TCTGATGGAAAGTTTTATTATTGTGCATGCTTACGCTGTCCTGGAGATAGTGTTCAAATA
TTACCAAACTACTAATAATTAAATTGA


>TTHERM_00242010(protein)
MNSQSTNTSSNSNNNHNNNSSSSNRILHDQFFQIRLARQGQDMNLNSNQIANSQPANFNF
YNYPAYNMQQPAINSNPLNPNLVNNRVIFMRRDDLERNGQRNQQPSRSTSYSYITNSNRG
ANHLIIESQVINMSPIGISSSNQQSNINSSNILDSDNDSTIIFQNQEEKDFIFGTENLAV
STENIDFVKCTICMHIYQNPIACGNCLNHFCTVCIREWLIRHPNTCPLCKNFREMRCVPM
LKNMLDKLQFFCTNKKNGCEEIIRYEQVIKHEDSCEYKIEICPVLGCGQQMIKKILDKHI
QEECEYVLSKCRWCEQQIKKKIIEEHEEACDQKEIICDLCGDIFQFKDQMDHNQKCPELI
LDCSWCSKKIKQKEIRDHEDCCGERIVRCQGCNYECCLNDHFLHNQTCQEIPVLCHRCQT
KMKRRELAVHTIESCIENIQKTSSQKIYQLENENRELKRQLTSIQNENQQEIIKINNIIT
KNNQNQPFQFSQIYKDQDIFVNQPANIALVREYKKKRRDRFVIVDFHKPLLDTNQQITFK
ILSRRSDWFAIGICDESNVYSSRRYHDIGHLSYLISANGILYSSHSANENWQNRSFQIEI
DNVISIQFLFKPGPSALQNSSNAQSQNNMQNINSSSNQVVPGNSEQNPINNNNFASSVQN
SQLNNQNNNVNSNNAANINMNSNNEEMRLNEMNSQNSQNINNNQGNINNQSHLIGSEMKL
KFINHTENQELIINLDSKQISDGKFYYCACLRCPGDSVQILPNYQQLN


>TTHERM_00242010(gene)
ATGAATAGTTAAAGCACGAATACTAGTTCAAATAGTAATAATAATCATAATAACAACTCT
AGTAGCAGTAACAGAATTCTGCATGATTAATTTTTTTAAATTAGATTGGCAAGGCAAGGT
CAGGATATGAATTTAAATTCTAATCAGATAGCTAATAGTCAACCTGCCAATTTTAACTTT
TATAATTATCCTGCATATAATATGCAATAACCTGCAATTAACAGCAATCCTCTAAATCCT
AATTTGGTAAATAATAGAGTCATTTTTATGAGGAGAGATGATTTAGAGAGAAATGGTTAG
AGGAATTAGTAGCCAAGTAGGTCTACAAGCTATTCGTATATAACTAACAGCAACAGAGGA
GCTAATCATCTAATTATTGAAAGCTAAGTCATTAACATGAGTCCGATCGGAATTTCTTCT
TCAAATCAATAAAGCAACATTAATAGTAGCAATATTCTTGACTCAGATAATGATAGTACC
ATCATTTTTTAGAATCAAGAAGAGAAGGATTTTATTTTTGGAACAGAAAATCTTGCTGTT
TCAACTGAAAATATTGATTTTGTTAAATGTACTATTTGTATGCATATTTATTAGAATCCT
ATTGCTTGTGGAAATTGCTTAAATCACTTCTGCACAGTTTGCATTAGAGAGTGGCTTATT
AGGCATCCTAATACCTGTCCTCTTTGCAAGAATTTTAGAGAGATGCGTTGTGTGCCTATG
TTAAAGAATATGCTTGATAAGCTATAATTTTTCTGCACAAATAAGAAAAACGGATGTGAA
GAAATAATAAGATATGAGTAAGTTATTAAGCACGAAGATAGCTGCGAATATAAAATAGAA
ATTTGTCCTGTCTTAGGCTGTGGATAGTAGATGATTAAGAAAATATTAGATAAGCACATT
CAAGAAGAATGTGAGTATGTGCTTTCTAAGTGTCGCTGGTGTGAATAATAAATCAAAAAA
AAGATAATTGAAGAACATGAGGAGGCATGCGATTAGAAGGAAATAATTTGTGATTTATGT
GGTGATATTTTCTAATTTAAAGACTAAATGGATCATAATTAGAAATGTCCTGAATTAATC
TTAGATTGCTCTTGGTGCAGTAAAAAGATCAAATAAAAAGAAATTAGAGATCATGAAGAC
TGCTGTGGAGAAAGAATAGTCAGATGTTAAGGCTGCAACTATGAGTGCTGCTTGAATGAT
CACTTCCTTCACAATCAGACATGCCAGGAAATCCCAGTCTTATGTCATAGGTGTTAAACA
AAAATGAAACGCCGAGAACTAGCAGTCCATACCATAGAATCTTGCATTGAAAATATCTAA
AAGACATCCAGCTAAAAAATATACCAATTAGAAAATGAAAATCGTGAATTAAAACGACAA
TTAACATCAATTCAAAATGAAAATTAACAAGAAATAATAAAAATTAACAACATAATAACA
AAAAATAATTAAAATCAACCTTTCTAGTTTTCATAGATTTACAAAGATCAAGATATATTT
GTTAATCAACCTGCAAATATAGCACTTGTTAGAGAGTACAAAAAGAAGAGAAGAGACAGA
TTTGTTATTGTTGATTTTCATAAACCTCTTTTAGATACTAATCAACAGATTACCTTCAAA
ATCTTGTCTCGTAGATCTGATTGGTTTGCAATTGGAATTTGTGACGAATCTAATGTTTAT
TCCTCACGTCGCTACCACGATATTGGTCATCTGTCTTATCTCATATCGGCAAACGGAATA
CTCTACTCTTCTCATAGTGCCAATGAAAATTGGTAAAATAGGTCTTTCTAGATTGAAATA
GACAATGTAATATCAATCTAATTTTTATTCAAACCAGGTCCTTCGGCTCTATAAAATTCT
TCGAATGCCTAATCATAGAATAACATGTAAAATATAAATTCATCAAGCAACCAAGTAGTT
CCTGGCAATAGCGAATAGAATCCAATAAACAATAACAATTTTGCAAGCAGTGTATAAAAT
AGTTAATTAAATAATTAAAATAATAATGTAAATAGTAATAATGCTGCTAATATAAATATG
AATTCAAATAATGAAGAAATGAGGCTTAATGAGATGAACTCTTAAAACAGCTAAAATATT
AATAATAATCAAGGCAATATCAATAATCAAAGCCATTTGATTGGCTCAGAAATGAAGTTA
AAATTTATAAATCACACTGAAAATTAAGAACTTATAATTAACCTAGATAGCAAGCAAATC
TCTGATGGAAAGTTTTATTATTGTGCATGCTTACGCTGTCCTGGAGATAGTGTTCAAATA
TTACCAAACTACTAATAATTAAATTGA