Identifiers and Description

Gene Model Identifier

TTHERM_00239260

Standard Name

None

Aliases

PreTt18864 | 20.m00328 | 3706.m00094

Description

Zinc finger, C2H2 type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00239260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07873.15.997217567989865e-168zinc finger, C2H2 type family
protein (368 aa)
OxytrichaContig18583.0.g1002.0001081030036656e-67Zinc-finger double domain
Stentor CoeruleusSteCoe_334008.75651076269652e-27
WormBaseWBGene000038472.000130478826482e-26locus:blmp-1 status:Partiall
y_confirmed UniProt:Q93560
protein_id:CAB01695.1
DictyBaseDDB_G02913423.001290106883431e-24tacA on chromosome: 6 position
140829 to 143261
SGDYJL056C7.000924640675686e-24ZAP1 Zinc-regulated transcript
ion factor; binds to zinc-resp
onsive promoters to induce tra
nscription of certain genes in
presence of zinc, represses o
ther genes in low zinc; regula
tes its own transcription; con
tains seven zinc-finger domain
s

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00239260(coding)
ATGGAATTAGAATCTTAAAATTAATCTAACTAACCTGAACAATTAGACGATGAAGCAGAT
GATAATGAAAGGGAATAGAATTATGATGAAAATCAAAATAGTGACTAGTCTGATGATGAA
GAAGAAATCGATGAAGATTCAAAGCAAGAAATGCAAATTGATGAAGAAGAGGATGAAGAT
GACAATGAAGGAGATTTGGACAACCAAGATGGTTAATAAAACAGTCAGAGTCAAAAAAAA
ATGTCTAAAATGAATGATTAAACAAATGGAGAGAGTGAATTCGATAGATCAAACTTTGAA
AAAACTTAAGGTTAAACATCTAATCAACTAGAGAATGAAATGAGTGAAGAAGCAGTTGCA
ATGATTCCAAAAAAGGTTAAAAAATGGGAATTAGTTTGGGTAAGAGTTTAAAATGTTTGG
GACTTTCATTCAGATATGTATATCCGTAAATGGATATGTTCAAATAAAAAGGATGATGGA
AATTCAGAAGTTAATGGAATAGCTATATAGGCACATCCTCAACTTAAAGATAGCACTAAA
TAAAATTCAACTTCAGCTAATAATGCCCAGGGAAGTAATGGATCTGCTGCTAATCCAGAT
AAAGCAGCAGCTGTTTCAGGTTCTTCTAAAGGAGAAAATTCAGCTTAGTAAGGTGCAGGC
GCTGGAAGTAACGGTTAAGGAGGTAGTTTAAAACCAAGAACAACTCCTAAAAGCAAAGAA
AAAACTTAAGTTACAGTATAAAAAGAATACAAATGTAAACAAGAAGACTGTGGTAAAGTA
TTTTTAGATTCATCTGCTCTAAAAAAGCATATGCTAACCCACGGTGCCAAAATGTATGTT
TGCTAAGTTGAAGGTTGTGGTAAGAGATTTGTTGACAACTCAAAATTAAGGAGACACTAA
CTTGTACACACAGGTGAAAGGCCATTTAGATGTGAAATTTGTGGTAAAAGTTTTTCCCTT
GACTTTAATTTAAAGACTCACTTAAGGACTCATACAGGTGAAAAACCATACGTTTGTAAA
TTCCCTGGTTGTGATAAACGCTTTACTTAATCCTCAAACCTTTCTGCTCATGAAAAATCT
CATTATGTAAAAGAAAAGAGATGA


>TTHERM_00239260(protein)
MELESQNQSNQPEQLDDEADDNEREQNYDENQNSDQSDDEEEIDEDSKQEMQIDEEEDED
DNEGDLDNQDGQQNSQSQKKMSKMNDQTNGESEFDRSNFEKTQGQTSNQLENEMSEEAVA
MIPKKVKKWELVWVRVQNVWDFHSDMYIRKWICSNKKDDGNSEVNGIAIQAHPQLKDSTK
QNSTSANNAQGSNGSAANPDKAAAVSGSSKGENSAQQGAGAGSNGQGGSLKPRTTPKSKE
KTQVTVQKEYKCKQEDCGKVFLDSSALKKHMLTHGAKMYVCQVEGCGKRFVDNSKLRRHQ
LVHTGERPFRCEICGKSFSLDFNLKTHLRTHTGEKPYVCKFPGCDKRFTQSSNLSAHEKS
HYVKEKR


>TTHERM_00239260(gene)
TTCTTATTATGGCGGAAATAATTAATTAATGTTAATATTTTGACATCAATAAATAGAAAG
AAAGCATGCAAACAAGCAAAAATTTATTAAATTAAAATTTGTTTATTAAGATATTATTAG
ATAATTTATTAAAATGGAAAATATATTAAAGAATTAATAGCAAAAAAAATTGTGAAAAAG
GAGGGAAGAAAATAAAAAAGACAATACTTGTAAGAGGAAGAGAAAGAAGAACTAAATAAA
TAAAATTAAACTACAATATTATAAGTTATACCACATCAAATGGAATTAGAATCTTAAAAT
TAATCTAACTAACCTGAACAATTAGACGATGAAGCAGATGATAATGAAAGGGAATAGAAT
TATGATGAAAATCAAAATAGTGACTAGTCTGATGATGAAGAAGAAATCGATGAAGATTCA
AAGCAAGAAATGCAAATTGATGAAGAAGAGGATGAAGATGACAATGAAGGAGATTTGGAC
AACCAAGATGGTTAATAAAACAGTCAGAGTCAAAAAAAAATGTCTAAAATGTATCTATTT
CATTTTAAAAATTAAATTTAAATTCATCTTTCTAGCGTTTTTTTTTTAGTGATAAAATAA
AACAATTATTAAGTATAACAAAAATAAATTTGTAACATTATTTTAAATGTTATCAAAGGA
ATGATTAAACAAATGGAGAGAGTGAATTCGATAGATCAAACTTTGAAAAAACTTAAGGTT
AAACATCTAATCAACTAGAGAATGAAATGAGTGAAGAAGCAGTTGCAATGATTCCAAAAA
AGGTTAAAAAATGGGAATTAGTTTGGGTAAAAAACTACTTTGAAATAGCAAATATTTCAA
TTAAATATCAAATTTTCTATTTTTGTAAAGCTTTTTAGTTTAAATTGCATGCTTTCATTT
GCAAATAATGAGCTCAATTATAAATCTTTAAAATTTATGAAGAGAGCAATTTATTTATTT
ATTTAGAAAATTGCATTTAATTTAAATTAATTAAAAAGATATCAGAAAATTGTTTGATTC
AAAAATCTTTTAAAATATTTTATATAAACAGAAAAAAAAAATATTTAATTTATTAAATAA
AAATAATATTTTATTTATGAATAAACAAACTTAGGTAAGAGTTTAAAATGTTTGGGACTT
TCATTCAGATATGTATATCCGTAAATGGATATGTTCAAATAAAAAGGATGATGGAAATTC
AGAAGTTAATGGAATAGCTATATAGGCACATCCTCAACTTAAAGATAGCACTAAATAAAA
TTCAACTTCAGCTAATAATGCCCAGGGAAGTAATGGATCTGCTGCTAATCCAGATAAAGC
AGCAGCTGTTTCAGGTTCTTCTAAAGGAGAAAATTCAGCTTAGTAAGGTGCAGGCGCTGG
AAGTAACGGTTAAGGAGGTAGTTTAAAACCAAGAACAACTCCTAAAAGCAAAGAAAAAAC
TTAAGTTACAGTATAAAAAGAATACAAATGTAAACAAGAAGACTGTGGTAAAGTATTTTT
AGATTCATCTGCTCTAAAAAAGCATATGCTAACCCACGGTGCCAAAATGTATGTTTGCTA
AGTTGAAGGTTGTGGTAAGAGATTTGTTGACAACTCAAAATTAAGGAGACACTAACTTGT
ACACACAGGTGAAAGGCCATTTAGATGTGAAATTTGTGGTAAAAGTTTTTCCCTTGACTT
TAATTTAAAGACTCACTTAAGGACTCATACAGGTGAAAAACCATACGTTTGTAAATTCCC
TGGTTGTGATAAACGCTTTACTTAATCCTCAAACCTTTCTGCTCATGAAAAATCTCATTA
TGTAAAAGAAAAGAGATGA