Identifiers and Description

Gene Model Identifier

TTHERM_00238830

Standard Name

None

Aliases

PreTt18822 | 20.m00286 | 3706.m00052

Description

Serine/threonine protein phosphatase PP1, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00149 ) Ser/Thr protein phosphatase family protein
  • ( TIGR00668 ) bis(5'-nucleosyl)-tetraphosphatase (symmetrical)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00238830

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD02231 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02232 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02233 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02234 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02271 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02272 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02273 ) Macronucleus: V5 tagged PP36 protein
  • ( SD02274 ) Macronucleus: V5 tagged PP36 protein

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_309710
WormBaseWBGene000017489.997093137033517e-262locus:gsp-2 Serine/threonine
-protein phosphatase PP1-beta
status:Confirmed UniProt:P
48727 protein_id:CCD61828.1
Tetrahymena borealisEI9_07910.19.997093137033517e-262serine/threonine protein phosp
hatase PP1 (322 aa)
DictyBaseDDB_G02756199.997093137033517e-262pppB on chromosome: 2 position
6106886 to 6107851
OxytrichaContig11781.0.0.g159.997093137033517e-262Calcineurin-like phosphoestera
se
SGDYER133W9.997093137033517e-262GLC7 Type 1 serine/threonine p
rotein phosphatase catalytic s
ubunit, involved in many proce
sses (eg: glycogen metabolism,
sporulation, mitosis); accumu
lates at mating projections by
interaction with Afr1p; inter
acts with many regulatory subu
nits

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00238830(coding)
ATGGTTGATAAAGGTGCAAAATAAGTTGACATCGATGTAGATAGCATCATCGAAAAGCTT
ATTGCTTGTAAGGAATACAAGCCAGGTAAATAGGCAAGTATGACAGAATAAGAAATAAGA
GGTTTGTGCATAAAAGCTAGAGAAATTTTCATTAATTAACCCATTCTCCTTGAGCTCGAA
GCACCACTAAAAATTTGCGGTGATATTCACGGACAATATTATGATTTGCTTCGTCTCTTC
TAATACGGCCATTATCCTCCCGATACTAACTATTTATTCTTAGGTGATTATGTTGATAGA
GGTAAATAAAGTTTAGAAACAATAGCTCTTTTACTTGCATACAAAATAAAATATCCTGAG
AACTTCTTCTTACTGAGAGGTAATCATGAATGCGCATCAATTAATAGAATCTATGGTTTC
TACGATGAATGTAAAAGAAGATACAATATAAAGCTTTGGAAGACTTTCACTGACTGCTTC
AACTGCTTACCTGTTGCTGCAGTTATAGATGAAAAAATCTTCTGTATGCATGGTGGTTTA
TCTCCTGAACTTACTAATCTTGAATAAATCCGTCGTATTATTAGACCCACTGATGTTCCC
GATACTGGTTTATTATGCGATTTACTTTGGAGTGATCCTGATAAAGATGTATAGGGTTGG
GCAGAAAATGAAAGAGGTGTTTCTTATGTATTTAGTCCAGAAATAGTATCAGTATTCCTG
AAAAAGCATGAGTTAGATTTGATATGCCGTGCACATTAGGTTGTAGAAGATGGATATGAA
TTCTTTGCTAAAAGATAATTAGTAACCTTATTCTCAGCTCCTAATTATTGTGGTGAATTT
GATAACGCAGGTGCTATGATGACTGTAGATGAAACTTTGATGTGTTCTTTCTAAATTTTG
AAACCTGCTGATAGCAGAACTACTGGATAAGCTGGCAGACCTTATACTCCTCCTAAAAGC
AAGTGA


>TTHERM_00238830(protein)
MVDKGAKQVDIDVDSIIEKLIACKEYKPGKQASMTEQEIRGLCIKAREIFINQPILLELE
APLKICGDIHGQYYDLLRLFQYGHYPPDTNYLFLGDYVDRGKQSLETIALLLAYKIKYPE
NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAVIDEKIFCMHGGL
SPELTNLEQIRRIIRPTDVPDTGLLCDLLWSDPDKDVQGWAENERGVSYVFSPEIVSVFL
KKHELDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMTVDETLMCSFQIL
KPADSRTTGQAGRPYTPPKSK


>TTHERM_00238830(gene)
ATGGTTGATAAAGGTGCAAAATAAGTTGACATCGATGTAGATAGCATCATCGAAAAGCTT
ATTGCTTGTAAGGAATACAAGCCAGGTAAATAGGCAAGTATGACAGAATAAGAAATAAGA
GGTTTGTGCATAAAAGCTAGAGAAATTTTCATTAATTAACCCATTCTCCTTGAGCTCGAA
GCACCACTAAAAATTTGCGGTAAATTAAATTCTGATTTTAAAAATTCCAAGAGCTGAACT
CAGATGATAGTTTTCCTACAAAAGCAAAAACGATTTCTCTTAATAACATATAGGTGATAT
TCACGGACAATATTATGATTTGCTTCGTCTCTTCTAATACGGCCATTGTAAATATTTCAT
TTATTTTATCTTTTTTGAGCAAGCAACAAGAAACTAACTAATTTACAGATAAATAAATAT
ATATATCTCTCTTTTCGTTTTAATTATATGATTGACTTCTAGCTTTTTTATATATTTTCT
TTGATTTGCGTCTCTAACAAAAATGTTCAAACGCAAATTTATTAAGTCTTTTAAGACTCT
GCATAAAAAAAAATTTGATAGTTAAGAGACGGATATATTCATCTAAATAAAAGCCTGTTG
CTTACTTTCTTATAATTTATTAACATTCTTTTTCTTAACAAATAGATCCTCCCGATACTA
ACTATTTATTCTTGTAAGATTATTTTTAATCAAACTCAAATTCAAATAGCTTATCTCCAG
CGCGTCTTAGTTTGAAAAAAATACAAAATATTTAAGTATTGTCTGTCTAAAATGCTTTCA
AAAGTCTAAAATGACAAATATCTGTATAGCAAAGCTAGCAATTTAATCACTTTTAAGCAT
ATAATATACTTTTTTTTGCTTAGTTAATATCCTTCTTTGCATTAATCACCTCTTAAATCA
CTAAATTTAAATAAAATGGGTTCAGTAGAAAATATTCAATAGTAAATACAATTTAAAATA
AAAATAAAATAGCAAACCAGTAGAATGTATTCATCCGCATGTGATTTCGTGATATTACCC
AAGTTTAATGACTGAAATCCTTAATAGCATACATAGCTAGAAAATATTAGCTTTTTGAGC
AGAAATAAAATGAAATTTGCAATTTTTTTAAAAAAAGTTTAAATTCTTTCCAATATATAT
TGATAGTAATTAAGTAGTTGAACAAGTCATGCTGTGCTTAAAAGTGGTTGATTGAAACTA
AACGCGAATTACAAATCTTTACAATAATAAATTTTGCTTATCTCCTAATCTTTTTTTTAA
AAAAAATAGAGGTGATTATGTTGATAGAGGTAAATAAAGTTTAGAAACAATAGCTCTTTT
ACTTGCATACAAAATAAAATATCCTGAGAACTTCTTCTTACTGAGAGGTAATCATGAATG
CGCATCAATTAATAGAATCTATGGTTTCTACGATGAATGTAATAAATAATTATATAAAAA
TTATTGACAAAAAATATTTTGTTTCATATTGTTTTTAAATAGCTCAAAATATTTAAAATA
GATATTAAGCAATAAACTCAATTTAAAATAATTACTAGGTAAAAGAAGATACAATATAAA
GCTTTGGAAGACTTTCACTGACTGCTTCAACTGCTTACCTGTTGCTGCAGTTATAGATGA
AAAAATCTTCTGTATGCATGGTGGTTTATCTCCTGAACTTACTAATCTTGAATAAATCCG
TCGTATTATTAGACCCACTGATGTTCCCGATACTGGTAATTAATATCTTTAAAAATTGCG
CTTAGATCATCCAATAAATTAATTTATTATCTTCAAGGTTTATTATGCGATTTACTTTGG
AGTGATCCTGATAAAGATGTATAGGGTTGGGCAGAAAATGAAAGAGGTGTTTCTTATGTA
TTTAGTCCAGAAATAGTATCAGTATTCCTGAAAAAGCATGAGTTAGATTTGATATGCCGT
GCACATTAGGTAAAATTTACTTTAAGTTATTTAGAAAAAGTTACTTTTAAAGTTATATGA
AAAACTTCCGAGTTTAAATATTAATAAAACATAATAAAACTAGAGAGAATAAATAAATAA
GTTACAAATAATATAAATAGAAAAATAAAACTATAATATATTAATTATGTAGACAAATTT
ATAAAAATTATACTTCTAACTAATTAGGTTGTAGAAGATGGATATGAATTCTTTGCTAAA
AGATAATTAGTAACCTTATTCTCAGCTCCTAATTATTGTGGTGAATTTGATAACGCAGGT
AATTATTTAAATACAAACAAGGTTTGTAAATAAAGTAATAATTAATTAAATACTTTTTGA
TTATAATTTAGGTGCTATGATGACTGTAGATGAAACTTTGATGTGTTCTTTCTAAATTTT
GAAACCTGCTGATAGCAGAACTACTGGATAAGCTGGCAGACCTTATACTCCTCCTAAAAG
CAAGGTAATATTATTAAGATATTATTGAAAAAATAATAATTAATTTTTGTTGCTTGTATA
AAAATAGTGA