Identifiers and Description

Gene Model Identifier

TTHERM_00237610

Standard Name

JUB1 (Junk Buster 1)

Aliases

PreTt18805 | 20.m00269 | 3706.m00036

Description

hypothetical protein; Heterochromatin Body Component Jub1p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00237610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07931.19.997093137033517e-262hypothetical protein (935 aa)

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
COI16,
JUB6,
COI6,
COI3,
HPL2,
JUB4,
JUB2,
JUB3
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.
110JUB1,
PDD1
Jub1p promotes heterochromatin body formation and dephosphorylation of the Heterochromatin Protein 1-like protein Pdd1p. Because Pdd1p dephosphorylation promotes the electrostatic interaction between Pdd1p and RNA in vitro and heterochromatin body formation in vivo, it has been proposed that heterochromatin body is assembled by the Pdd1p-RNA interaction.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00237610(coding)
ATGAAAAAAATTATCAAAATTTAAAAGAAAGAAGATTAAAATAATCAAGAAGCCAAGTTA
GTTAAAAGTTAAAAAAAATATGGCTCAAATTAAGATGATGAATTTTTATTGTAAGATGAA
TTACTTAATTGCAGTTTTGAATCTGACTAAGAATTGAAAGAATTCAGCTAAATGTTCTAA
AAGTATGACAAACAGATCTAGTAGAAACAATAAATTTAATTAAGGAGTTAAACTTAGAAG
AATTACTAGGAATAAAATGATTAATCTAATCACTATTAAAAATAAAAACCTCCAAAAATA
AAACCTTTTCACTTGTAAAACAAAGGAAAAAATGCAATCTAGATTGAAAAAAAACACTAA
TCAAACTCTAAATATTCAGATAGCTTTGACTCAGATGAAGATCAAATTTTGAAAAAGTAT
TTCGATGCTACCTAAAATGATCATTTTAAATAAATATTAAATGATGAGGATTCTTCTGAC
TTTAATTATCATGAATAGAGAAACACCAGAAGTAACAGTTAACTTATACATGCTAATAGG
AGTAACAAGAGTTAAAATTATTTTGAAAGTGAAAACAGACATAAATCTTAAATACAAGAG
AAAAATAATGGTTTTAATTCCAAGATAAATGAAAAGAGAAATTTGTCATAAATTTTACCT
AAAAGGCCTCATACTGAAGATGATTAATCGAATTCAAATTCTGAATAAGAAACTAAGAAG
CTAGAAAAATAGCTAGATTAAGATCATAATTCATAAAGTTTAAAGCTAACCAAAAAGCTT
ATCCTTAAAAAGAGTATTATCTCACCACCTTAACAATAACAGTACTTGACACCTTCTGCA
GTTTAATCGAATAAAATGGAATCTGTATCTGAAAATCCTATTAAAGCTAAAACTGTATCG
AATTCTGCATGTTCTCCAATTAGAATGGATAGTTTACATAAATTATTTGAAGAGAGTTAG
GTTGAAGATATTCAAGGCTCATTTGAGAAAGGTCACTAAGCTTTAAGTATGCAAATTCAT
GACTATTCGAATGACCAGTATTTAGTAGAATGGAAAAATATTTAATCAAAACATATTGAT
AGCGTTAGAATCAAACCAAAGAGCACTGTCTACAAGTTAAGTGAAATCAAGAAACATGCT
CCTGAAATATATGTTTAGTTCCTAGAAACTCAATTTGGCGACTTTTAAAAGTATAAGCAT
GAACAATCTCATTAAGAAAAAGAGCTTATTTAAAAGAAGCAATTTTAAGATAGTAGCTCG
TATGTTATTAAGGTAACTCATGAATCAAATGATAAATAAAATGAAGAACAGAAACATCAT
CCTAATCCAAAGTTGTTGTTATAAGAAACCAAAGAGGCTAAAAGCCAATTAAGCTCTCAA
TAGTAATTAGAGGAGATCAATCCTTCTTGCTTTAATTGTGATGAAAAGTTGAACTCAAAG
AATTTGAACGAATAAGAAGAACTTCTCTTCGAAAATAAATAGGAAATAGCAAAAGAACCT
TCAGAGCATAAGCCTTTAGATGGAGAATAAGAATATAAGCCTTAAGAGTAATTATAAGAT
AAAACCTACTCTGAGGTTTTAATGAACTAAGTTTAAGAATTACCATAAGATATTTCATTT
GAAGACCAAGAAAGCTTACAGAAATAATAATCTGTGGAAATTGTTTTACCAGTAGAAAAT
TAAAAGTAAAATACTTCAGAGATTGTTGAAGAAAGCAATTTAGAGGATAAGACAACTACA
TAGATTGAATAAGAATCACTAGAAACTGAAAAGGACTCTGCTATTTTTGAATCTAAAGAT
GAAAATTAGAATAATTAGAAAGATCAAGTTTGTCTTTAAAATGATAAATAACATTCTAAA
GCTATTTCTGTAGAAGAAGGAGAAATAGTAGAATAAGATACAAATTCTTAACCAATTCAC
AAAGAATAGAATTCAACCTCTTAAGCTGCTACAAATGAAGAGATGCAAATAGAAGAGCCT
AATGAAAAAGTAAATGAACTCTTTGAAGTAGAAAATAACTAGCAAAACAAAACAAAGAGT
GTTGAGAAAACTACTTCAACAGAAAAAATGATGGAAAAGCTGACTGTTAATACCGAGGAA
CTAATGTAAACTCCTGAAAAAAAAAAATCTCAATCAAAGGAATTAGAAATTGAAGTTAAA
GAAAAGAAAATAATTCAGATAGACCTAGACACTTATTAGGAAGATGAAGAGGAAGAAGAG
GAGTAGGAAATAAGTGATGATCTAAATTCTCATATTCCTTAGGTCAAATTTTAAAACTTG
AAAGACAACAAAATAAATACATAAGAAGTAGAAGAACTTAAATGCAAAGAAGGTGATGAC
CTATTCGAACCAATTGTTACTGATCACCATCTACATGAGCATTAACATTTGCATGCTAAA
GAAATTTTTGAAAATCATTCTACAAAGTCGAAACTTGAAGTAATTCCAGAGGTTGGGAAT
GACTCGGAAAGTGATTAAAGTTGCTAAAATAGATTATTAAATAGTTCTATAAGATCATTC
GATAAGTAAGCTCAAGGGAAAAAGAATTCTAGTGTTGAGATGGTAGAAGATGATGTAGTA
GAATATACCTAAAATAATTTACATACTGCTCCTCTTGTATATCCAGTTCAATCTAGACCA
ATAAAAGTACATATAAATTAACCACGTGTAGTAGCTGCTAGAAAATCTACTGGTGTATAG
ATTAAGCAAACTAATTTTAATGACAGTTCAGAAGAAGAAAATAGCTATGAAATTGAAGAA
GATTACAACTAATAGGAAAGTGCTAATTCTTTACTATCTGGAACTCTCGGAAGATTTAAA
TCAAGAATTGAGAAGCTTCTTTGA


>TTHERM_00237610(protein)
MKKIIKIQKKEDQNNQEAKLVKSQKKYGSNQDDEFLLQDELLNCSFESDQELKEFSQMFQ
KYDKQIQQKQQIQLRSQTQKNYQEQNDQSNHYQKQKPPKIKPFHLQNKGKNAIQIEKKHQ
SNSKYSDSFDSDEDQILKKYFDATQNDHFKQILNDEDSSDFNYHEQRNTRSNSQLIHANR
SNKSQNYFESENRHKSQIQEKNNGFNSKINEKRNLSQILPKRPHTEDDQSNSNSEQETKK
LEKQLDQDHNSQSLKLTKKLILKKSIISPPQQQQYLTPSAVQSNKMESVSENPIKAKTVS
NSACSPIRMDSLHKLFEESQVEDIQGSFEKGHQALSMQIHDYSNDQYLVEWKNIQSKHID
SVRIKPKSTVYKLSEIKKHAPEIYVQFLETQFGDFQKYKHEQSHQEKELIQKKQFQDSSS
YVIKVTHESNDKQNEEQKHHPNPKLLLQETKEAKSQLSSQQQLEEINPSCFNCDEKLNSK
NLNEQEELLFENKQEIAKEPSEHKPLDGEQEYKPQEQLQDKTYSEVLMNQVQELPQDISF
EDQESLQKQQSVEIVLPVENQKQNTSEIVEESNLEDKTTTQIEQESLETEKDSAIFESKD
ENQNNQKDQVCLQNDKQHSKAISVEEGEIVEQDTNSQPIHKEQNSTSQAATNEEMQIEEP
NEKVNELFEVENNQQNKTKSVEKTTSTEKMMEKLTVNTEELMQTPEKKKSQSKELEIEVK
EKKIIQIDLDTYQEDEEEEEEQEISDDLNSHIPQVKFQNLKDNKINTQEVEELKCKEGDD
LFEPIVTDHHLHEHQHLHAKEIFENHSTKSKLEVIPEVGNDSESDQSCQNRLLNSSIRSF
DKQAQGKKNSSVEMVEDDVVEYTQNNLHTAPLVYPVQSRPIKVHINQPRVVAARKSTGVQ
IKQTNFNDSSEEENSYEIEEDYNQQESANSLLSGTLGRFKSRIEKLL


>TTHERM_00237610(gene)
ATGAAAAAAATTATCAAAATTTAAAAGAAAGAAGATTAAAATAATCAAGAAGCCAAGTTA
GTTAAAAGTTAAAAAAAATATGGCTCAAATTAAGATGATGAATTTTTATTGTAAGATGAA
TTACTTAATTGCAGTTTTGAATCTGACTAAGAATTGAAAGAATTCAGCTAAATGTTCTAA
AAGTATGACAAACAGATCTAGTAGAAACAATAAATTTAATTAAGGAGTTAAACTTAGAAG
AATTACTAGGAATAAAATGATTAATCTAATCACTATTAAAAATAAAAACCTCCAAAAATA
AAACCTTTTCACTTGTAAAACAAAGGAAAAAATGCAATCTAGATTGAAAAAAAACACTAA
TCAAACTCTAAATATTCAGATAGCTTTGACTCAGATGAAGATCAAATTTTGAAAAAGTAT
TTCGATGCTACCTAAAATGATCATTTTAAATAAATATTAAATGATGAGGATTCTTCTGAC
TTTAATTATCATGAATAGAGAAACACCAGAAGTAACAGTTAACTTATACATGCTAATAGG
AGTAACAAGAGTTAAAATTATTTTGAAAGTGAAAACAGACATAAATCTTAAATACAAGAG
AAAAATAATGGTTTTAATTCCAAGATAAATGAAAAGAGAAATTTGTCATAAATTTTACCT
AAAAGGCCTCATACTGAAGATGATTAATCGAATTCAAATTCTGAATAAGAAACTAAGAAG
CTAGAAAAATAGCTAGATTAAGATCATAATTCATAAAGTTTAAAGCTAACCAAAAAGCTT
ATCCTTAAAAAGAGTATTATCTCACCACCTTAACAATAACAGTACTTGACACCTTCTGCA
GTTTAATCGAATAAAATGGAATCTGTATCTGAAAATCCTATTAAAGCTAAAACTGTATCG
AATTCTGCATGTTCTCCAATTAGAATGGATAGTTTACATAAATTATTTGAAGAGAGTTAG
GTTGAAGATATTCAAGGCTCATTTGAGAAAGGTCACTAAGCTTTAAGTATGCAAATTCAT
GACTATTCGAATGACCAGTATTTAGTAGAATGGAAAAATATTTAATCAAAACATATTGAT
AGCGTTAGAATCAAACCAAAGAGCACTGTCTACAAGTAAATATCGTTTATATTTTGAACT
TAAAATTTATTATTTTTATTTTTAAAGGTTAAGTGAAATCAAGAAACATGCTCCTGAAAT
ATATGTTTAGTTCCTAGAAACTCAATTTGGCGACTTTTAAAAGTATAAGCATGAACAATC
TCATTAAGAAAAAGAGCTTATTTAAAAGAAGCAATTTTAAGATAGTAGCTCGTATGTTAT
TAAGGTAACTCATGAATCAAATGATAAATAAAATGAAGAACAGAAACATCATCCTAATCC
AAAGTTGTTGTTATAAGAAACCAAAGAGGCTAAAAGCCAATTAAGCTCTCAATAGTAATT
AGAGGAGATCAATCCTTCTTGCTTTAATTGTGATGAAAAGTTGAACTCAAAGAATTTGAA
CGAATAAGAAGAACTTCTCTTCGAAAATAAATAGGAAATAGCAAAAGAACCTTCAGAGCA
TAAGCCTTTAGATGGAGAATAAGAATATAAGCCTTAAGAGTAATTATAAGATAAAACCTA
CTCTGAGGTTTTAATGAACTAAGTTTAAGAATTACCATAAGATATTTCATTTGAAGACCA
AGAAAGCTTACAGAAATAATAATCTGTGGAAATTGTTTTACCAGTAGAAAATTAAAAGTA
AAATACTTCAGAGATTGTTGAAGAAAGCAATTTAGAGGATAAGACAACTACATAGATTGA
ATAAGAATCACTAGAAACTGAAAAGGACTCTGCTATTTTTGAATCTAAAGATGAAAATTA
GAATAATTAGAAAGATCAAGTTTGTCTTTAAAATGATAAATAACATTCTAAAGCTATTTC
TGTAGAAGAAGGAGAAATAGTAGAATAAGATACAAATTCTTAACCAATTCACAAAGAATA
GAATTCAACCTCTTAAGCTGCTACAAATGAAGAGATGCAAATAGAAGAGCCTAATGAAAA
AGTAAATGAACTCTTTGAAGTAGAAAATAACTAGCAAAACAAAACAAAGAGTGTTGAGAA
AACTACTTCAACAGAAAAAATGATGGAAAAGCTGACTGTTAATACCGAGGAACTAATGTA
AACTCCTGAAAAAAAAAAATCTCAATCAAAGGAATTAGAAATTGAAGTTAAAGAAAAGAA
AATAATTCAGATAGACCTAGACACTTATTAGGAAGATGAAGAGGAAGAAGAGGAGTAGGA
AATAAGTGATGATCTAAATTCTCATATTCCTTAGGTCAAATTTTAAAACTTGAAAGACAA
CAAAATAAATACATAAGAAGTAGAAGAACTTAAATGCAAAGAAGGTGATGACCTATTCGA
ACCAATTGTTACTGATCACCATCTACATGAGCATTAACATTTGCATGCTAAAGAAATTTT
TGAAAATCATTCTACAAAGTCGAAACTTGAAGTAATTCCAGAGGTTGGGAATGACTCGGA
AAGTGATTAAAGTTGCTAAAATAGATTATTAAATAGTTCTATAAGATCATTCGATAAGTA
AGCTCAAGGGAAAAAGAATTCTAGTGTTGAGATGGTAGAAGATGATGTAGTAGAATATAC
CTAAAATAATTTACATACTGCTCCTCTTGTATATCCAGTTCAATCTAGACCAATAAAAGT
ACATATAAATTAACCACGTGTAGTAGCTGCTAGAAAATCTACTGGTGTATAGATTAAGCA
AACTAATTTTAATGACAGTTCAGAAGAAGAAAATAGCTATGAAATTGAAGAAGATTACAA
CTAATAGGAAAGTGCTAATTCTTTACTATCTGGAACTCTCGGAAGATTTAAATCAAGAAT
TGAGAAGCTTCTTTGA